| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 836 |
Name | CASP3 |
Synonym | CPP32|CPP32B|SCA-1;caspase 3, apoptosis-related cysteine peptidase;CASP3;caspase 3, apoptosis-related cysteine peptidase |
Definition | CASP-3|CPP-32|PARP cleavage protease|SREBP cleavage activity 1|Yama|apopain|caspase 3, apoptosis-related cysteine protease|caspase-3|cysteine protease CPP32|procaspase3|protein Yama |
Position | 4q34 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Activation of DNA fragmentation factor;PID Reactome;500275 |
Pathway | p75(NTR)-mediated signaling;PID Curated;200103 |
Pathway | d4gdi signaling pathway;PID BioCarta;100191 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | SMAC-mediated dissociation of IAP:caspase complexes;PID Reactome;500934 |
Pathway | Caspase-mediated cleavage of cytoskeletal proteins;PID Reactome;500271 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | trefoil factors initiate mucosal healing;PID BioCarta;100018 |
Pathway | Stimulation of the cell death response by PAK-2p34;PID Reactome;500276 |
Pathway | LPA receptor mediated events;PID Curated;200011 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | apoptotic signaling in response to dna damage;PID BioCarta;100204 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | Apoptotic cleavage of cellular proteins;PID Reactome;500270 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | west nile virus;PID BioCarta;100001 |
Pathway | Activation of caspases through apoptosome-mediated cleavage;PID Reactome;500267 |
Pathway | FAS signaling pathway;PANTHER;P00020 |
Pathway | tnfr1 signaling pathway;PID BioCarta;100015 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | tsp-1 induced apoptosis in microvascular endothelial cell;PID BioCarta;100010 |
Pathway | fas signaling pathway (cd95);PID BioCarta;100167 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | apoptotic dna-fragmentation and tissue homeostasis;PID BioCarta;100187 |
Pathway | Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120 |
Pathway | Apoptotic execution phase;PID Reactome;500269 |
Pathway | caspase cascade in apoptosis;PID BioCarta;100218 |
Pathway | regulation of cell cycle progression by plk3;PID BioCarta;100068 |
Pathway | Huntington disease;PANTHER;P00029 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | granzyme a mediated apoptosis pathway;PID BioCarta;100035 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | b cell survival pathway;PID BioCarta;100228 |
Pathway | Apoptotic cleavage of cell adhesion proteins;PID Reactome;500272 |
Pathway | FAS (CD95) signaling pathway;PID Curated;200067 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | Role of DCC in regulating apoptosis;PID Reactome;500280 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Reticulosarcoma;FunDO |
Disease | Central nervous system disease;FunDO |
Disease | Dermatitis;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Moyamoya disease;FunDO |
Disease | Intracranial aneurysm;FunDO |
Disease | Hydrocephalus;FunDO |
Disease | Systemic scleroderma;FunDO |
Disease | Periodontitis;FunDO |
Disease | Sudden infant death syndrome;FunDO |
Disease | Vulvar disease;FunDO |
Disease | Cancer;FunDO |
Disease | Rabies;FunDO |
Disease | Down syndrome;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | Cholestasis;FunDO |
External Links | |
Links to Entrez Gene | 836 |
Links to all GeneRIF Items | 836 |
Links to iHOP | 836 |
Sequence Information | |
Nucleotide Sequence | >836 : length: 834 atggagaacactgaaaactcagtggattcaaaatccattaaaaatttggaaccaaagatc atacatggaagcgaatcaatggactctggaatatccctggacaacagttataaaatggat tatcctgagatgggtttatgtataataattaataataagaattttcataaaagcactgga atgacatctcggtctggtacagatgtcgatgcagcaaacctcagggaaacattcagaaac ttgaaatatgaagtcaggaataaaaatgatcttacacgtgaagaaattgtggaattgatg cgtgatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc catggtgaagaaggaataatttttggaacaaatggacctgttgacctgaaaaaaataaca aactttttcagaggggatcgttgtagaagtctaactggaaaacccaaacttttcattatt caggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgatgat gacatggcgtgtcataaaataccagtggaggccgacttcttgtatgcatactccacagca cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtcgctttgt gccatgctgaaacagtatgccgacaagcttgaatttatgcacattcttacccgggttaac cgaaaggtggcaacagaatttgagtccttttcctttgacgctacttttcatgcaaagaaa cagattccatgtattgtttccatgctcacaaaagaactctatttttatcactaa |
Protein Sequence | >836 : length: 277 MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH |