| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 356 |
Name | FASLG |
Synonym | APT1LG1|CD178|CD95-L|CD95L|FASL|TNFSF6;Fas ligand (TNF superfamily, member 6);FASLG;Fas ligand (TNF superfamily, member 6) |
Definition | APTL|CD95 ligand|apoptosis (APO-1) antigen ligand 1|apoptosis antigen ligand|fas antigen ligand|tumor necrosis factor (ligand) superfamily, member 6|tumor necrosis factor ligand superfamily member 6 |
Position | 1q23 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | akt signaling pathway;PID BioCarta;100245 |
Pathway | IL2 signaling events mediated by STAT5;PID Curated;200158 |
Pathway | Calcium signaling in the CD4+ TCR pathway;PID Curated;200159 |
Pathway | pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | FAS signaling pathway;PANTHER;P00020 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | fas signaling pathway (cd95);PID BioCarta;100167 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | FAS (CD95) signaling pathway;PID Curated;200067 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | FasL/ CD95L signaling;PID Reactome;500255 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255 |
Pathway | FoxO family signaling;PID Curated;200091 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | Ischemia;FunDO |
Disease | IMMUNE;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | Sicca syndrome;FunDO |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Silicosis;FunDO |
Disease | Bladder cancer;FunDO |
Disease | Lung cancer;FunDO |
Disease | lupus erythematosus;GAD |
Disease | Melanoma;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Nervous system disease;FunDO |
Disease | Respiratory distress syndrome;FunDO |
Disease | bladder cancer;GAD |
Disease | Breast cancer;FunDO |
Disease | HIV infection;FunDO |
Disease | Malignant glioma;FunDO |
Disease | Liver cancer;FunDO |
Disease | Neoplasm metastasis;FunDO |
Disease | Hypercholesterolemia;FunDO |
Disease | Embryoma;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Gallbaldder cancer;FunDO |
Disease | Chronic simple glaucoma;FunDO |
Disease | lung cancer;GAD |
Disease | cervical cancer;GAD |
Disease | Anemia;FunDO |
Disease | Multiple myeloma;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | Leukemia;FunDO |
Disease | chronic lymphocytic leukaemia;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Dental plaque;FunDO |
Disease | Autoimmune lymphoproliferative syndromes;KEGG DISEASE;H00108 |
Disease | Pancreas cancer;FunDO |
Disease | Neoplasms;GAD |
Disease | Colon cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Cholangiocarcinoma;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | METABOLIC;GAD |
Disease | Gastritis;FunDO |
Disease | esophageal cancer;GAD |
Disease | Celiac disease;NHGRI |
Disease | Celiac Disease;GAD |
Disease | Seminoma;FunDO |
Disease | Keratoconjunctivitis Sicca;FunDO |
Disease | HELLP syndrome;FunDO |
Disease | CANCER;GAD |
Disease | melanoma;GAD |
Disease | Systemic lupus erythematosus, susceptibility;OMIM |
Disease | Neuritis;FunDO |
Disease | Endometriosis;FunDO |
Disease | Primary immunodeficiency;KEGG DISEASE |
Disease | Cholestasis;FunDO |
Disease | REPRODUCTION;GAD |
Disease | Hepatitis B;FunDO |
Disease | azoospermia oligospermia;GAD |
Disease | Cervical cancer;FunDO |
Disease | Abortion;FunDO |
Disease | Lupus vulgaris;FunDO |
Disease | Celiac disease;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | body mass diabetes, type 2 insulin;GAD |
Disease | Waldenstrom macroglobulinaemia;GAD |
Disease | multiple sclerosis;GAD |
Disease | Hydrocephalus;FunDO |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 356 |
Links to all GeneRIF Items | 356 |
Links to iHOP | 356 |
Sequence Information | |
Nucleotide Sequence | >356 : length: 846 atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct ggtcaaaggaggccaccaccaccaccgccaccgccaccactaccacctccgccgccgccg ccaccactgcctccactaccgctgccacccctgaagaagagagggaaccacagcacaggc ctgtgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggcctgggg atgtttcagctcttccacctacagaaggagctggcagaactccgagagtctaccagccag atgcacacagcatcatctttggagaagcaaataggccaccccagtccaccccctgaaaaa aaggagctgaggaaagtggcccatttaacaggcaagtccaactcaaggtccatgcctctg gaatgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggc cttgtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaa tcttgcaacaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccag gatctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcc cgcagcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaac gtatctgagctctctctggtcaattttgaggaatctcagacgtttttcggcttatataag ctctaa |
Protein Sequence | >356 : length: 281 MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |