| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3558 |
Name | IL2 |
Synonym | IL-2|TCGF|lymphokine;interleukin 2;IL2;interleukin 2 |
Definition | T cell growth factor|aldesleukin|interleukin-2|involved in regulation of T-cell clonal expansion |
Position | 4q26-q27 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | IL12 signaling mediated by STAT4;PID Curated;200197 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | IL2 signaling events mediated by STAT5;PID Curated;200158 |
Pathway | Calcium signaling in the CD4+ TCR pathway;PID Curated;200159 |
Pathway | Regulation of Telomerase;PID Curated;200072 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | il 2 signaling pathway;PID BioCarta;100130 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | the 41bb-dependent immune response;PID BioCarta;100257 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | IL2 signaling events mediated by PI3K;PID Curated;200099 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | Lupus erythematosus;FunDO |
Disease | atopy;GAD |
Disease | IMMUNE;GAD |
Disease | Type 1 diabetes;NHGRI |
Disease | gastric atrophy;GAD |
Disease | Infection;FunDO |
Disease | graft-versus-host disease;GAD |
Disease | Lung cancer;FunDO |
Disease | Melanoma;FunDO |
Disease | Hepatitis C;FunDO |
Disease | multiple sclerosis;GAD |
Disease | Diabetes;KEGG DISEASE |
Disease | Severe combined immunodeficiency due to IL2 deficiency;OMIM |
Disease | Embryoma;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Wiskott-Aldrich syndrome;FunDO |
Disease | sclerosis, systemic;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Leukemia;FunDO |
Disease | periodontitis;GAD |
Disease | Schizophrenia;FunDO |
Disease | INFECTION;GAD |
Disease | Celiac disease;NHGRI |
Disease | prostate cancer;GAD |
Disease | Celiac Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | rheumatoid arthritis;GAD |
Disease | CANCER;GAD |
Disease | Lymphopenia;FunDO |
Disease | Rheumatoid arthritis;NHGRI |
Disease | Stress disorder, post-traumatic;FunDO |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | Helicobacter Infections;GAD |
Disease | Alopecia areata;NHGRI |
Disease | Alimentary system disease;FunDO |
Disease | Renal Cell cancer;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | type 1 diabetes;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | Cerebrovascular disorder;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Filariasis;FunDO |
External Links | |
Links to Entrez Gene | 3558 |
Links to all GeneRIF Items | 3558 |
Links to iHOP | 3558 |
Sequence Information | |
Nucleotide Sequence | >3558 : length: 462 atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agacccagggacttaatcagcaatatcaacgtaatagttctggaactaaagggatctgaa acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga tggattaccttttgtcaaagcatcatctcaacactgacttga |
Protein Sequence | >3558 : length: 153 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT |