| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1493 |
Name | CTLA4 |
Synonym | CD|CD152|CELIAC3|CTLA-4|GRD4|GSE|ICOS|IDDM12;cytotoxic T-lymphocyte-associated protein 4;CTLA4;cytotoxic T-lymphocyte-associated protein 4 |
Definition | CD152 isoform|celiac disease 3|cytotoxic T lymphocyte associated antigen 4 short spliced form|cytotoxic T-lymphocyte antigen 4|cytotoxic T-lymphocyte protein 4|cytotoxic T-lymphocyte-associated antigen 4|cytotoxic T-lymphocyte-associated serine esterase-4 |
Position | 2q33 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | the co-stimulatory signal during t-cell activation;PID BioCarta;100193 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | atopy;GAD |
Disease | inflammatory bowel disease;GAD |
Disease | liver disease;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | Thymoma;FunDO |
Disease | Diabetes;KEGG DISEASE |
Disease | Bronchiolitis;FunDO |
Disease | hepatitis C;GAD |
Disease | autoimmune hypothyroidism;GAD |
Disease | thyroiditis, chronic lymphocytic;GAD |
Disease | colorectal cancer;GAD |
Disease | Graves Ophthalmopathy;GAD |
Disease | Hyperthyroidism;FunDO |
Disease | INFECTION;GAD |
Disease | Colon cancer;FunDO |
Disease | Cervical cancer;FunDO |
Disease | cirrhosis, biliary primary;GAD |
Disease | PSYCH;GAD |
Disease | Liver Cirrhosis, Biliary;GAD |
Disease | Celiac disease;NHGRI |
Disease | Graves' disease;FunDO |
Disease | Renal Cell cancer;FunDO |
Disease | hepatitis, autoimmune;GAD |
Disease | Celiac disease, susceptibility to;OMIM |
Disease | multiple sclerosis;GAD |
Disease | Enteritis;FunDO |
Disease | Asthma;GAD |
Disease | cardiomyopathy, idiopathic dilated;GAD |
Disease | H-Thyroiditis;GAD |
Disease | Diabetes mellitus, insulin-dependent, susceptibility to;OMIM |
Disease | Coeliac;GAD |
Disease | Grave`s disease;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | pregnancy loss, recurrent;GAD |
Disease | oral submucous fibrosis;GAD |
Disease | lymphoma;GAD |
Disease | Alcoholic liver disease;FunDO |
Disease | Graves' disease;GAD |
Disease | Migraine;FunDO |
Disease | Alopecia areata;NHGRI |
Disease | soluble cytotoxic T lymphocyte-associated antigen-4;GAD |
Disease | Ulcerative colitis;FunDO |
Disease | rhinitis;GAD |
Disease | bronchial hyperresponsiveness;GAD |
Disease | Hemolytic anemia;FunDO |
Disease | Dermatitis;FunDO |
Disease | Pancreatitis;FunDO |
Disease | sclerosis, systemic;GAD |
Disease | kidney transplant;GAD |
Disease | Anemia;GAD |
Disease | HIV;GAD |
Disease | Hypothyroidism, autoimmune;OMIM |
Disease | Total IgE;GAD |
Disease | ophthalmopathy, Graves';GAD |
Disease | myeloma, multiple;GAD |
Disease | allogeneic stem cell transplantation;GAD |
Disease | METABOLIC;GAD |
Disease | diabetes, type 1;GAD |
Disease | myasthenia gravis;GAD |
Disease | preeclampsia;GAD |
Disease | systemic sclerosis;GAD |
Disease | Rheumatoid arthritis;NHGRI |
Disease | Crohn's disease;GAD |
Disease | Bipolar disorder;FunDO |
Disease | atopic dermatitis;GAD |
Disease | vitiligo;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | schizophrenia;GAD |
Disease | liver transplant;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | ulcerative colitis;GAD |
Disease | IMMUNE;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | Graves disease, susceptibility to, 4;OMIM |
Disease | dermatitis and eczema;GAD |
Disease | Asthma;FunDO |
Disease | Arthritis, Rheumatoid;GAD |
Disease | Multiple Myeloma;GAD |
Disease | Prostate cancer;FunDO |
Disease | Mycosis fungoides;FunDO |
Disease | Addison's disease;GAD |
Disease | Graves' disease;KEGG DISEASE;H00082 |
Disease | Leukemia;FunDO |
Disease | Behcet Syndrome;GAD |
Disease | lupus erythematosus;GAD |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | systemic lupus erythematosus;GAD |
Disease | autoimmune thyroid disease;GAD |
Disease | cirrhosis, alcoholic;GAD |
Disease | diabetes, type 2;GAD |
Disease | Multiple malignancy;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Generalized anxiety disorder;FunDO |
Disease | rheumatoid arthritis;GAD |
Disease | Glomerulonephritis;FunDO |
Disease | oral squamous cell cancer;GAD |
Disease | Graves' hyperthyroidism;GAD |
Disease | REPRODUCTION;GAD |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | Lymphoma;FunDO |
Disease | Diabetes Mellitus;GAD |
Disease | Hashimoto's thyroiditis;KEGG DISEASE;H00081 |
Disease | Abortion;FunDO |
Disease | Type 1 diabetes;NHGRI |
Disease | breast cancer;GAD |
Disease | diabetes, latent autoimmune;GAD |
Disease | hypothyroidism, autoimmune;GAD |
Disease | Hepatitis C;FunDO |
Disease | Gingival overgrowth;FunDO |
Disease | Graves disease;GAD |
Disease | Hepatitis B, Chronic;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Hashimoto's thyroiditis;GAD |
Disease | Wegener's granulomatosis;GAD |
Disease | autoimmune hepatitis;GAD |
Disease | VISION;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Hashimoto's thryoiditis;GAD |
Disease | Pretibial myxedema;GAD |
Disease | coeliac disease;GAD |
Disease | diabetes, type 1 with AITD;GAD |
Disease | Autoimmune disease;FunDO |
Disease | Primary biliary cirrhosis;FunDO |
Disease | susceptibility to autoimmune disease;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | thyroid disease, autoimmune;GAD |
Disease | Celiac Disease;GAD |
Disease | Colitis, Ulcerative;GAD |
Disease | Graves' disease ophthalmology;GAD |
Disease | CANCER;GAD |
Disease | diabetes, type 1 thyroid autoimmunity;GAD |
Disease | autoimmune disease;GAD |
Disease | Fuchs heterochromic cyclitis;GAD |
Disease | type 1 diabetes;GAD |
Disease | autoimmune response;GAD |
Disease | cardiomyopathy;GAD |
Disease | Lupus;GAD |
Disease | thrombocytopenic purpura, idiopathic;GAD |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 1493 |
Links to all GeneRIF Items | 1493 |
Links to iHOP | 1493 |
Sequence Information | |
Nucleotide Sequence | >1493 : length: 525 atggcttgccttggatttcagcggcacaaggctcagctgaacctggctaccaggacctgg ccctgcactctcctgttttttcttctcttcatccctgtcttctgcaaagcaatgcacgtg gcccagcctgctgtggtactggccagcagccgaggcatcgccagctttgtgtgtgagtat gcatctccaggcaaagccactgaggtccgggtgacagtgcttcggcaggctgacagccag gtgactgaagtctgtgcggcaacctacatgatggggaatgagttgaccttcctagatgat tccatctgcacgggcacctccagtggaaatcaagtgaacctcactatccaaggactgagg gccatggacacgggactctacatctgcaaggtggagctcatgtacccaccgccatactac ctgggcataggcaacggaacccagatttatgtaattgctaaagaaaagaagccctcttac aacaggggtctatgtgaaaatgcccccaacagagccagaatgtga |
Protein Sequence | >1493 : length: 174 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEY ASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLR AMDTGLYICKVELMYPPPYYLGIGNGTQIYVIAKEKKPSYNRGLCENAPNRARM |