| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 637 |
Name | BID |
Synonym | FP497;BH3 interacting domain death agonist;BID;BH3 interacting domain death agonist |
Definition | BH3-interacting domain death agonist|BID isoform ES(1b)|BID isoform L(2)|BID isoform Si6|Human BID coding sequence|apoptic death agonist|desmocollin type 4|p22 BID |
Position | 22q11.1 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | induction of apoptosis through dr3 and dr4/5 death receptors;PID BioCarta;100189 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890 |
Pathway | Activation and oligomerization of BAK protein;PID Reactome;501018 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | Activation of BAD and translocation to mitochondria;PID Reactome;500261 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | Activation, myristolyation of BID and translocation to mitochondria;PID Reactome;500259 |
Pathway | FAS signaling pathway;PANTHER;P00020 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | apoptotic signaling in response to dna damage;PID BioCarta;100204 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | FAS (CD95) signaling pathway;PID Curated;200067 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | Intrinsic Pathway for Apoptosis;PID Reactome;500258 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Activation, translocation and oligomerization of BAX;PID Reactome;501012 |
Disease | Cancer;FunDO |
External Links | |
Links to Entrez Gene | 637 |
Links to all GeneRIF Items | 637 |
Links to iHOP | 637 |
Sequence Information | |
Nucleotide Sequence | >637 : length: 588 atggactgtgaggtcaacaacggttccagcctcagggatgagtgcatcacaaacctactg gtgtttggcttcctccaaagctgttctgacaacagcttccgcagagagctggacgcactg ggccacgagctgccagtgctggctccccagtgggagggctacgatgagctgcagactgat ggcaaccgcagcagccactcccgcttgggaagaatagaggcagattctgaaagtcaagaa gacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagc atccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggag gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaga gacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggcc agtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccag aacctacgcacctacgtgaggagcttagccagaaatgggatggactga |
Protein Sequence | >637 : length: 195 MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ NLRTYVRSLARNGMD |