| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 627 |
Name | BDNF |
Synonym | -;brain-derived neurotrophic factor;BDNF;brain-derived neurotrophic factor |
Definition | abrineurin|neurotrophin |
Position | 11p13 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Metabotropic glutamate receptor group II pathway;PANTHER;P00040 |
Pathway | p75(NTR)-mediated signaling;PID Curated;200103 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Huntington disease;PANTHER;P00029 |
Disease | bulimia eating disorder;GAD |
Disease | ADHD;GAD |
Disease | bulimia;GAD |
Disease | obsessive-compulsive disorder;GAD |
Disease | rumination;GAD |
Disease | WAGRO syndrome;OMIM |
Disease | Depression;FunDO |
Disease | Bronchiolitis;FunDO |
Disease | personality disorders;GAD |
Disease | anorexia nervosa;GAD |
Disease | hippocampal volume;GAD |
Disease | Parkinson's disease;GAD |
Disease | schizophrenia weight gain;GAD |
Disease | Fragile X Syndrome;GAD |
Disease | eating disorders;GAD |
Disease | PSYCH;GAD |
Disease | brain activity;GAD |
Disease | personality traits;GAD |
Disease | Psychotic disorder;FunDO |
Disease | Parkinsons disease;GAD |
Disease | Central hypoventilation syndrome, congenital;OMIM |
Disease | Bulimia nervosa, age of onset of weight loss in;OMIM |
Disease | substance abuse;GAD |
Disease | Obsessive-compulsive disorder;FunDO |
Disease | Atherosclerosis;FunDO |
Disease | Migraine;FunDO |
Disease | weight;GAD |
Disease | reasoning skills;GAD |
Disease | obsessive compulsive disorder;GAD |
Disease | depression stroke;GAD |
Disease | Dermatitis;FunDO |
Disease | cognitive function;GAD |
Disease | depression;GAD |
Disease | Subarachnoid hemorrhage;FunDO |
Disease | Urogenital abnormalities;FunDO |
Disease | Drug abuse;FunDO |
Disease | psychoses;GAD |
Disease | epilepsy;GAD |
Disease | Bipolar disorder;FunDO |
Disease | Memory impairment, susceptibility to;OMIM |
Disease | body mass;GAD |
Disease | schizophrenia;GAD |
Disease | cognitive function schizophrenia;GAD |
Disease | childhood-onset mood disorders;GAD |
Disease | bipolar disorder;GAD |
Disease | Rett syndrome;FunDO |
Disease | Multiple myeloma;FunDO |
Disease | Asthma;FunDO |
Disease | Body mass index;GAD |
Disease | Huntington disease;FunDO |
Disease | BDNF serum concentrations;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | Dental plaque;FunDO |
Disease | alcoholism;GAD |
Disease | Multiple System Atrophy;GAD |
Disease | Autistic disorder;FunDO |
Disease | depressive disorder, major hippocampal volume;GAD |
Disease | METABOLIC;GAD |
Disease | Coronary Artery Disease;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Fibromyalgia;FunDO |
Disease | methamphetamine abuse;GAD |
Disease | Anorexia nervosa, susceptibility to;OMIM |
Disease | Obesity;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | introversion and neuroticism;GAD |
Disease | Alzheimer's disease;GAD |
Disease | Amyotrophic lateral sclerosis;FunDO |
Disease | Pulmonary fibrosis;FunDO |
Disease | Smoking behavior;NHGRI |
Disease | Obsessive-compulsive disorder, protection against;OMIM |
Disease | Stroke;FunDO |
Disease | cognitive ability;GAD |
Disease | Epilepsy;FunDO |
Disease | Lung disease;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | cognition;GAD |
Disease | Angina, Unstable;GAD |
Disease | smoking behavior;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | attention-deficit hyperactivity disorder;GAD |
Disease | eating disorders mood disorders schizophrenia substance abuse;GAD |
Disease | affective psychoses;GAD |
Disease | Weight;NHGRI |
Disease | Body mass index;NHGRI |
Disease | Behavior disease;FunDO |
Disease | serotonin transporter availability;GAD |
Disease | mood disorder;GAD |
External Links | |
Links to Entrez Gene | 627 |
Links to all GeneRIF Items | 627 |
Links to iHOP | 627 |
Sequence Information | |
Nucleotide Sequence | >627 : length: 744 atgaccatccttttccttactatggttatttcatactttggttgcatgaaggctgccccc atgaaagaagcaaacatccgaggacaaggtggcttggcctacccaggtgtgcggacccat gggactctggagagcgtgaatgggcccaaggcaggttcaagaggcttgacatcattggct gacactttcgaacacgtgatagaagagctgttggatgaggaccagaaagttcggcccaat gaagaaaacaataaggacgcagacttgtacacgtccagggtgatgctcagtagtcaagtg cctttggagcctcctcttctctttctgctggaggaatacaaaaattacctagatgctgca aacatgtccatgagggtccggcgccactctgaccctgcccgccgaggggagctgagcgtg tgtgacagtattagtgagtgggtaacggcggcagacaaaaagactgcagtggacatgtcg ggcgggacggtcacagtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatac ttctacgagaccaagtgcaatcccatgggttacacaaaagaaggctgcaggggcatagac aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggcccttaccatg gatagcaaaaagagaattggctggcgattcataaggatagacacttcttgtgtatgtaca ttgaccattaaaaggggaagatag |
Protein Sequence | >627 : length: 247 MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT LTIKRGR |