| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3553 |
Name | IL1B |
Synonym | IL-1|IL1-BETA|IL1F2;interleukin 1, beta;IL1B;interleukin 1, beta |
Definition | IL-1 beta|catabolin|interleukin-1 beta|preinterleukin 1 beta|pro-interleukin-1-beta |
Position | 2q14 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | signal transduction through il1r;PID BioCarta;100132 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Cellular roles of Anthrax toxin;PID Curated;200179 |
Pathway | IL1-mediated signaling events;PID Curated;200075 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Prion diseases;KEGG PATHWAY;hsa05020 |
Pathway | Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | Interleukin-1 signaling;PID Reactome;500490 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Disease | Coronary Restenosis;GAD |
Disease | atopy;GAD |
Disease | inflammatory bowel disease;GAD |
Disease | Premature birth;FunDO |
Disease | gastric carcinoma;GAD |
Disease | Helicobacter pylori infection;GAD |
Disease | Psoriasis;FunDO |
Disease | Respiratory distress syndrome;FunDO |
Disease | Henoch-Schoenlein purpura;FunDO |
Disease | Glaucoma;FunDO |
Disease | Alveolar bone loss;FunDO |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | INFECTION;GAD |
Disease | Cervical cancer;FunDO |
Disease | Asthma in men;GAD |
Disease | PSYCH;GAD |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Stroke;FunDO |
Disease | Graves' disease;FunDO |
Disease | Hypertension;FunDO |
Disease | multiple sclerosis;GAD |
Disease | Infectious lung disease;FunDO |
Disease | Synovial sarcoma;FunDO |
Disease | Infertility;FunDO |
Disease | Atherosclerosis;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | lymphoma;GAD |
Disease | Oral cancer;FunDO |
Disease | Lung cancer;FunDO |
Disease | Stomach Neoplasms;GAD |
Disease | Melanoma;FunDO |
Disease | recurrent pregnancy loss;GAD |
Disease | Ulcerative colitis;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | nephropathy, IgA;GAD |
Disease | rhinitis;GAD |
Disease | Retinoblastoma;FunDO |
Disease | Dermatitis;FunDO |
Disease | Amnionitis;FunDO |
Disease | bullous pemphigoid;GAD |
Disease | sclerosis, systemic;GAD |
Disease | gingival bleeding gingivitis;GAD |
Disease | Otitis media;FunDO |
Disease | Alzheimer's Disease and Vascular Dementia;GAD |
Disease | Drug abuse;FunDO |
Disease | Gastric cancer risk after H. pylori infection;OMIM |
Disease | Crohn's disease;GAD |
Disease | Helicobacter Infections;GAD |
Disease | chronic atrophic gastritis and gastric carcinoma;GAD |
Disease | Bipolar disorder;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Shigella infection;FunDO |
Disease | Esophagitis;FunDO |
Disease | Ovarian cancer;FunDO |
Disease | diabetic nephropathy;GAD |
Disease | Bacterial vaginosis;FunDO |
Disease | Gastritis;GAD |
Disease | ulcerative colitis;GAD |
Disease | Arthritis;FunDO |
Disease | Sicca syndrome;FunDO |
Disease | Parkinson's disease;GAD |
Disease | rate of decline in lung function in smokers;GAD |
Disease | Asthma;FunDO |
Disease | Multiple Myeloma;GAD |
Disease | AGING;GAD |
Disease | Neoplasm metastasis;FunDO |
Disease | rheumatoid arthritis;GAD |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | Dental plaque;FunDO |
Disease | Schizophrenia;FunDO |
Disease | depression;GAD |
Disease | METABOLIC;GAD |
Disease | Tuberculosis;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | gastric cancer;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | noncardia gastric cancer;GAD |
Disease | Labor, Premature;FunDO |
Disease | primary open-angle glaucoma;GAD |
Disease | Squamous cell cancer;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Alimentary system disease;FunDO |
Disease | Celiac disease;FunDO |
Disease | Leiomyoma;GAD |
Disease | stomach cancer;GAD |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Alzheimer's disease;GAD |
Disease | Hepatitis;FunDO |
Disease | Periodontitis;FunDO |
Disease | Hepatitis C;FunDO |
Disease | schizophrenia;GAD |
Disease | Hepatitis B, Chronic;GAD |
Disease | hepatocellular carcinoma;GAD |
Disease | Parkinson disease;FunDO |
Disease | bacterial vaginosis;GAD |
Disease | decreased bone mass in patients;GAD |
Disease | Cystic fibrosis;FunDO |
Disease | VISION;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | H. pylori infection;GAD |
Disease | Asthma;GAD |
Disease | periodontitis;GAD |
Disease | prevalent Type 2 Diabetes and related traits;GAD |
Disease | Sarcoidosis;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | cognitive ability;GAD |
Disease | Nephrosis;FunDO |
Disease | Epilepsy;FunDO |
Disease | Uterine Neoplasms;GAD |
Disease | bone density;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | lung cancer;GAD |
Disease | CANCER;GAD |
Disease | Lyme disease;FunDO |
Disease | Kidney failure;FunDO |
Disease | hypertension;GAD |
Disease | Endometriosis;FunDO |
Disease | NEUROLOGICAL;GAD |
Disease | burning mouth syndrome;GAD |
Disease | Gouts;FunDO |
Disease | Polymyositis;FunDO |
Disease | Hodgkin's disease;FunDO |
Disease | RENAL;GAD |
External Links | |
Links to Entrez Gene | 3553 |
Links to all GeneRIF Items | 3553 |
Links to iHOP | 3553 |
Sequence Information | |
Nucleotide Sequence | >3553 : length: 810 atggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggat gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc ttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccc tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa gaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacga tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact gacttcaccatgcaatttgtgtcttcctaa |
Protein Sequence | >3553 : length: 269 MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS |