| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3123 |
Name | HLA-DRB1 |
Synonym | DRB1|DRw10|HLA-DR1B|HLA-DRB|SS1;major histocompatibility complex, class II, DR beta 1;HLA-DRB1;major histocompatibility complex, class II, DR beta 1 |
Definition | DW2.2/DR2.2|HLA class II histocompatibility antigen, DR-1 beta chain|MHC class II HLA-DR beta 1 chain|MHC class II HLA-DR-beta cell surface glycoprotein|MHC class II HLA-DRw10-beta|MHC class II antigen|human leucocyte antigen DRB1|lymphocyte antigen DRB1 |
Position | 6p21.3 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | antigen processing and presentation;PID BioCarta;100107 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | role of mef2d in t-cell apoptosis;PID BioCarta;100109 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Hematopoietic cell lineage;KEGG PATHWAY;hsa04640 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | activation of csk by camp-dependent protein kinase inhibits signaling through the t cell receptor;PID BioCarta;100196 |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | t cell receptor signaling pathway;PID BioCarta;100022 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Pathway | the co-stimulatory signal during t-cell activation;PID BioCarta;100193 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | lck and fyn tyrosine kinases in initiation of tcr activation;PID BioCarta;100023 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | atopy;GAD |
Disease | liver disease;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | pollen allergy;GAD |
Disease | recurrent respiratory papillomatosis;GAD |
Disease | Diabetes;KEGG DISEASE |
Disease | Multiple sclerosis;NHGRI |
Disease | ocular cicatricial pemphigoid;GAD |
Disease | Multiple sclerosis, susceptibility to;OMIM |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | X-linked adrenoleukodystrophy;GAD |
Disease | Cardiac diseases;KEGG DISEASE |
Disease | INFECTION;GAD |
Disease | Takayasu Arteritis;GAD |
Disease | thryoiditis, chronic lymphocytic;GAD |
Disease | cirrhosis, biliary primary;GAD |
Disease | PSYCH;GAD |
Disease | Pre-Eclampsia;GAD |
Disease | alveolar echinococcosis;GAD |
Disease | recurrent oral ulcers;GAD |
Disease | (ANCA)-associated vasculitis;GAD |
Disease | Mite-sensitive asthma;GAD |
Disease | response to ximelagatran treatment;GAD |
Disease | hepatitis, autoimmune;GAD |
Disease | multiple sclerosis;GAD |
Disease | Polyendocrinopathies, Autoimmune;GAD |
Disease | sarcoidosis;GAD |
Disease | hypertension, pulmonary arterial;GAD |
Disease | Systemic lupus erythematosus;NHGRI |
Disease | Syndrome;GAD |
Disease | thyroiditis, Hashimoto's;GAD |
Disease | pregnancy loss, recurrent;GAD |
Disease | Immunoglobulin A;NHGRI |
Disease | lymphoma;GAD |
Disease | Graves' disease;GAD |
Disease | narcolepsy;GAD |
Disease | sickle cell anemia;GAD |
Disease | rhinitis;GAD |
Disease | hypertension;GAD |
Disease | sclerosis, systemic;GAD |
Disease | renal disease, end stage;GAD |
Disease | thyroid disease, autoimmune;GAD |
Disease | viral clearance;GAD |
Disease | posttreatment Th2 immune response to S. mansoni Ags;GAD |
Disease | Lumiracoxib-related liver injury;NHGRI |
Disease | pemphigus foliaceus;GAD |
Disease | diabetes, type 1;GAD |
Disease | myasthenia gravis;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | preeclampsia;GAD |
Disease | pancreatitis, autoimmune;GAD |
Disease | Systemic lupus erythematosus;KEGG DISEASE;H00080 |
Disease | Rheumatoid arthritis;NHGRI |
Disease | Crohn's disease;GAD |
Disease | epilepsy;GAD |
Disease | hypothyroidism, goitrous juvenile autoimmune;GAD |
Disease | vitiligo;GAD |
Disease | human papillomavirus infection;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | Azoospermia;GAD |
Disease | schizophrenia;GAD |
Disease | SLE;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Autism;GAD |
Disease | ulcerative colitis;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | Arthritis, Rheumatoid;GAD |
Disease | alpha 1-Antitrypsin Deficiency;GAD |
Disease | allergy;GAD |
Disease | rheumatic heart disease;GAD |
Disease | Multiple Myeloma;GAD |
Disease | birth weight body mass;GAD |
Disease | pulmonary tuberculosis;GAD |
Disease | increased prevalence and level of insulin autoantibodies;GAD |
Disease | Addison's disease;GAD |
Disease | Graves' disease;KEGG DISEASE;H00082 |
Disease | psoriasis;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | METABOLIC;GAD |
Disease | lupus erythematosus;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | systemic lupus erythematosus;GAD |
Disease | Response to ximelagatran treatment;NHGRI |
Disease | Hashimoto's thyroiditis;KEGG DISEASE;H00081 |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Arthritis (juvenile idiopathic);GAD |
Disease | Asthma;KEGG DISEASE;H00079 |
Disease | CARDIOVASCULAR;GAD |
Disease | Vogt-Koyanagi-Harada's disease;GAD |
Disease | Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294 |
Disease | coronary artery ectasia;GAD |
Disease | REPRODUCTION;GAD |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | autologous mixed lymphocyte reaction;GAD |
Disease | breast cancer;GAD |
Disease | Diabetes Mellitus;GAD |
Disease | SPT (cockroach);GAD |
Disease | thyroid carcinoma;GAD |
Disease | autoimmune thyroid disease;GAD |
Disease | Type 1 diabetes;NHGRI |
Disease | Alzheimer's disease;GAD |
Disease | Hepatitis B, Chronic;GAD |
Disease | blood group incompatibility;GAD |
Disease | Rheumatoid arthritis, susceptibility to;OMIM |
Disease | Graves disease;GAD |
Disease | hepatitis type 2, autoimmune;GAD |
Disease | Arthritis (juvenile idiopathic);NHGRI |
Disease | antineutrophil cytoplasmic antibody;GAD |
Disease | immune response to hepatitis B vaccine;GAD |
Disease | Circulatory system diseases;KEGG DISEASE |
Disease | VISION;GAD |
Disease | nephropathy in other diseases;GAD |
Disease | pancreatitis, chronic calcifying;GAD |
Disease | aortoarteritis;GAD |
Disease | delayed sleep phase syndrome.;GAD |
Disease | Asthma;GAD |
Disease | periodontitis;GAD |
Disease | psoriatic arthritis;GAD |
Disease | Lung Diseases;GAD |
Disease | cholangitis, sclerosing;GAD |
Disease | Vogt-Koyanagi-Harada syndrome;GAD |
Disease | Pemphigoid, susceptibility to;OMIM |
Disease | Celiac Disease;GAD |
Disease | gastric adenocarcinoma;GAD |
Disease | CANCER;GAD |
Disease | SPT (HDM);GAD |
Disease | giant cell arteritis;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | microscopic polyangiitis;GAD |
Disease | leukemia;GAD |
Disease | type 1 diabetes;GAD |
Disease | Anemia, Sickle Cell;GAD |
Disease | cardiomyopathy;GAD |
Disease | Sarcoidosis, susceptibility l, 1;OMIM |
Disease | Urticaria;GAD |
Disease | cervical cancer;GAD |
External Links | |
Links to Entrez Gene | 3123 |
Links to all GeneRIF Items | 3123 |
Links to iHOP | 3123 |
Sequence Information | |
Nucleotide Sequence | >3123 : length: 801 atggtgtgtctgaagctccctggaggctcctgcatgacagcgctgacagtgacactgatg gtgctgagctccccactggctttgtctggggacacccgaccacgtttcctgtggcagcct aagagggagtgtcatttcttcaatgggacggagcgggtgcggttcctggacagatacttc tataaccaggaggagtccgtgcgcttcgacagcgacgtgggggagttccgggcggtgacg gagctggggcggcctgacgctgagtactggaacagccagaaggacatcctggagcaggcg cgggccgcggtggacacctactgcagacacaactacggggttgtggagagcttcacagtg cagcggcgagtccaacctaaggtgactgtatatccttcaaagacccagcccctgcagcac cacaacctcctggtctgctctgtgagtggtttctatccaggcagcattgaagtcaggtgg ttcctgaacggccaggaagagaaggctgggatggtgtccacaggcctgatccagaatgga gactggaccttccagaccctggtgatgctggaaacagttcctcgaagtggagaggtttac acctgccaagtggagcacccaagcgtgacaagccctctcacagtggaatggagagcacgg tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag ccaacaggattcctgagctga |
Protein Sequence | >3123 : length: 266 MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYF YNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTV QRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNG DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL FLGAGLFIYFRNQKGHSGLQPTGFLS |