| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 1646 |
Name | AKR1C2 |
Synonym | AKR1C-pseudo|BABP|DD|DD2|DDH2|HAKRD|HBAB|MCDR2|SRXY8;aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);AKR1C2;aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) |
Definition | 3-alpha-HSD3|DD-2|DD/BABP|aldo-keto reductase family 1 member C2|chlordecone reductase homolog HAKRD|pseudo-chlordecone reductase|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|type II dihydrodiol dehydrogenase |
Position | 10p15-p14 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Steroid hormone biosynthesis;KEGG PATHWAY;hsa00140 |
Pathway | Metabolism of xenobiotics by cytochrome P450;KEGG PATHWAY;hsa00980 |
Disease | Esophageal disease;FunDO |
Disease | Bladder cancer;FunDO |
Disease | Barrett's esophagus;FunDO |
Disease | Breast cancer;FunDO |
Disease | Glaucoma;FunDO |
Disease | Obesity, hyperphagia, and developmental delay;OMIM |
External Links | |
Links to Entrez Gene | 1646 |
Links to all GeneRIF Items | 1646 |
Links to iHOP | 1646 |
Sequence Information | |
Nucleotide Sequence | >1646 : length: 420 atggattcgaaataccagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga tttggcacctatgcgcctgcagaggttcctaaaagtaaagctctagaggccgtcaaattg gcaatagaagccgggttccaccatattgattctgcacatgtttacaataatgaggagcag gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc tacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaa aggtcactgaaaaatcttcaattggactatgttgacctctatcttattcattttccagtg tctgtaaaggaggacatagggattttaacatggaagaagagccctaaacataactcctaa |
Protein Sequence | >1646 : length: 139 MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV SVKEDIGILTWKKSPKHNS |