| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 7507 |
Name | XPA |
Synonym | XP1|XPAC;xeroderma pigmentosum, complementation group A;XPA;xeroderma pigmentosum, complementation group A |
Definition | DNA repair protein complementing XP-A cells|excision repair-controlling|xeroderma pigmentosum group A-complementing protein |
Position | 9q22.3 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Formation of incision complex in GG-NER;PID Reactome;500060 |
Pathway | Global Genomic NER (GG-NER);PID Reactome;500058 |
Pathway | DNA Repair;Reactome;REACT:216 |
Pathway | Dual incision reaction in GG-NER;PID Reactome;500061 |
Pathway | Nucleotide excision repair;KEGG PATHWAY;hsa03420 |
Disease | reduced lung cancer risk and a modulating effect on nucleotide excision repair capacity;GAD |
Disease | Squamous cell cancer;FunDO |
Disease | Genetic disorders;KEGG DISEASE |
Disease | Ovarian disease;FunDO |
Disease | Inherited disorders of DNA repair systems;KEGG DISEASE |
Disease | lung cancer;GAD |
Disease | mild phenotype Xeroderma pigmentosum;GAD |
Disease | Lung cancer;FunDO |
Disease | CANCER;GAD |
Disease | Basal cell carcinoma;FunDO |
Disease | Testicular tumor;FunDO |
Disease | Xeroderma pigmentosum, group A;OMIM |
Disease | Neoplasms;GAD |
Disease | Colon cancer;FunDO |
Disease | Disorders of nucleotide excision repair;KEGG DISEASE;H00403 |
Disease | upper aerodigestive tract cancer;GAD |
Disease | Metabolism disease;FunDO |
External Links | |
Links to Entrez Gene | 7507 |
Links to all GeneRIF Items | 7507 |
Links to iHOP | 7507 |
Sequence Information | |
Nucleotide Sequence | >7507 : length: 822 atggcggcggccgacggggctttgccggaggcggcggctttagagcaacccgcggagctg cctgcctcggtgcgggcgagtatcgagcggaagcggcagcgggcactgatgctgcgccag gcccggctggctgcccggccctactcggcgacggcggctgcggctactggaggcatggct aatgtaaaagcagccccaaagataattgacacaggaggaggcttcattttagaagaggaa gaagaagaagaacagaaaattggaaaagttgttcatcaaccaggacctgttatggaattt gattatgtaatatgcgaagaatgtgggaaagaatttatggattcttatcttatgaaccac tttgatttgccaacttgtgataactgcagagatgctgatgataaacacaagcttataacc aaaacagaggcaaaacaagaatatcttctgaaagactgtgatttagaaaaaagagagcca cctcttaaatttattgtgaagaagaatccacatcattcacaatggggtgatatgaaactc tacttaaagttacagattgtgaagaggtctcttgaagtttggggtagtcaagaagcatta gaagaagcaaaggaagtccgacaggaaaaccgagaaaaaatgaaacagaagaaatttgat aaaaaagtaaaagaattgcggcgagcagtaagaagcagcgtgtggaaaagggagacgatt gttcatcaacatgagtatggaccagaagaaaacctagaagatgacatgtaccgtaagact tgtactatgtgtggccatgaactgacatatgaaaaaatgtga |
Protein Sequence | >7507 : length: 273 MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM |