| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 598 |
Name | BCL2L1 |
Synonym | BCL-XL/S|BCL2L|BCLX|BCLXL|BCLXS|Bcl-X|PPP1R52|bcl-xL|bcl-xS;BCL2-like 1;BCL2L1;BCL2-like 1 |
Definition | apoptosis regulator Bcl-X|bcl-2-like protein 1|protein phosphatase 1, regulatory subunit 52 |
Position | 20q11.21 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | Class I PI3K signaling events mediated by Akt;PID Curated;200169 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | ErbB1 downstream signaling;PID Curated;200113 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Pancreatic cancer;KEGG PATHWAY;hsa05212 |
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | EPO signaling pathway;PID Curated;200157 |
Pathway | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | CD40/CD40L signaling;PID Curated;200031 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Pathway | IL2 signaling events mediated by STAT5;PID Curated;200158 |
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | ras signaling pathway;PID BioCarta;100047 |
Pathway | apoptotic signaling in response to dna damage;PID BioCarta;100204 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | opposing roles of aif in apoptosis and cell survival;PID BioCarta;100249 |
Pathway | Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076 |
Pathway | regulation of bad phosphorylation;PID BioCarta;100233 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | IL2 signaling events mediated by PI3K;PID Curated;200099 |
Disease | Autoimmune disease;FunDO |
Disease | Ischemia;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | Glaucoma;FunDO |
Disease | Thyroid gland disease;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Multiple sclerosis;FunDO |
Disease | Severe acute respiratory syndrome;FunDO |
Disease | Lymphopenia;FunDO |
Disease | Cancer;FunDO |
Disease | Parkinson disease;FunDO |
Disease | Dental plaque;FunDO |
Disease | Rabies;FunDO |
Disease | Asthma;FunDO |
Disease | HIV infection;FunDO |
Disease | Neck cancer;FunDO |
Disease | Polyarthritis;FunDO |
External Links | |
Links to Entrez Gene | 598 |
Links to all GeneRIF Items | 598 |
Links to iHOP | 598 |
Sequence Information | |
Nucleotide Sequence | >598 : length: 513 atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggca gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggatacttttgtggaactctatgggaacaatgcagcagccgagagc cgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtggccggcgtg gttctgctgggctcactcttcagtcggaaatga |
Protein Sequence | >598 : length: 170 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |