| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 596 |
Name | BCL2 |
Synonym | Bcl-2|PPP1R50;B-cell CLL/lymphoma 2;BCL2;B-cell CLL/lymphoma 2 |
Definition | apoptosis regulator Bcl-2|protein phosphatase 1, regulatory subunit 50 |
Position | 18q21.33|18q21.3 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Apoptosis;Reactome;REACT:578 |
Pathway | transcription regulation by methyltransferase of carm1;PID BioCarta;100220 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | Ceramide signaling pathway;PID Curated;200100 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | telomeres telomerase cellular aging and immortality;PID BioCarta;100021 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | IL2 signaling events mediated by STAT5;PID Curated;200158 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | EPO signaling pathway;PID Curated;200157 |
Pathway | BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members;PID Reactome;500890 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | stress induction of hsp regulation;PID BioCarta;100142 |
Pathway | Activation of BAD and translocation to mitochondria;PID Reactome;500261 |
Pathway | Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014 |
Pathway | Apoptosis signaling pathway;PANTHER;P00006 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | inhibition of cellular proliferation by gleevec;PID BioCarta;100154 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | role of mitochondria in apoptotic signaling;PID BioCarta;100106 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | melanocyte development and pigmentation pathway;PID BioCarta;100108 |
Pathway | Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141 |
Pathway | apoptotic signaling in response to dna damage;PID BioCarta;100204 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | RXR and RAR heterodimerization with other nuclear receptor;PID Curated;200112 |
Pathway | Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076 |
Pathway | Apoptosis;KEGG PATHWAY;hsa04210 |
Pathway | HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133 |
Pathway | regulation of bad phosphorylation;PID BioCarta;100233 |
Pathway | il-7 signal transduction;PID BioCarta;100125 |
Pathway | prion pathway;PID BioCarta;100062 |
Pathway | Oxidative stress response;PANTHER;P00046 |
Pathway | IL2 signaling events mediated by PI3K;PID Curated;200099 |
Pathway | Caspase cascade in apoptosis;PID Curated;200148 |
Pathway | ceramide signaling pathway;PID BioCarta;100206 |
Pathway | Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156 |
Pathway | C-MYB transcription factor network;PID Curated;200130 |
Disease | CANCER;GAD |
Disease | Drug abuse;FunDO |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Gastric cancer;KEGG DISEASE;H00018 |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Oropharyngeal Neoplasms;GAD |
Disease | Brain ischemia;FunDO |
Disease | Asthma;FunDO |
Disease | Cancer;FunDO |
Disease | Carcinoma, Squamous Cell;GAD |
Disease | Ischemia;FunDO |
Disease | Eating disorder;FunDO |
Disease | HIV infection;FunDO |
Disease | Esotropia;FunDO |
Disease | Keratosis;FunDO |
Disease | Herpes;FunDO |
Disease | Eye cancer;FunDO |
Disease | lung cancer;GAD |
Disease | IMMUNE;GAD |
Disease | Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE |
Disease | Thyroid gland disease;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Kaposi's sarcoma;KEGG DISEASE;H00041 |
Disease | Choriocarcinoma;KEGG DISEASE;H00028 |
Disease | Dental plaque;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | Stroke;FunDO |
Disease | Viral infections;KEGG DISEASE |
Disease | Glaucoma;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | leukemia/lymphoma, T-Cell;GAD |
Disease | Autoimmune disease;FunDO |
Disease | chronic obstructive pulmonary disease/COPD lung function;GAD |
Disease | Tuberculosis;FunDO |
Disease | Lichen planus;FunDO |
Disease | Chronic lymphocytic leukemia (CLL);KEGG DISEASE;H00005 |
Disease | Infections caused by dsDNA viruses;KEGG DISEASE |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Graves' disease;FunDO |
Disease | Leukemia/lymphoma, B-cell, 2;OMIM |
Disease | Schistosomiasis;FunDO |
Disease | Hodgkin's disease;GAD |
Disease | Neoplasm Recurrence, Local;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Lupus erythematosus;FunDO |
Disease | Small cell lung cancer;KEGG DISEASE;H00013 |
Disease | leukemia;GAD |
Disease | Cervical cancer;KEGG DISEASE;H00030 |
Disease | follicular lymphoma to diffuse large-cell lymphoma;GAD |
Disease | Celiac disease;FunDO |
Disease | Nasopharyngeal cancer;KEGG DISEASE;H00054 |
Disease | Congenital abnormality;FunDO |
Disease | follicular lymphoma;GAD |
Disease | Autistic disorder;FunDO |
Disease | Head and neck cancers;KEGG DISEASE |
Disease | systemic lupus erythematosus;GAD |
Disease | Lupus;GAD |
External Links | |
Links to Entrez Gene | 596 |
Links to all GeneRIF Items | 596 |
Links to iHOP | 596 |
Sequence Information | |
Nucleotide Sequence | >596 : length: 720 atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga |
Protein Sequence | >596 : length: 239 MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |