| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 4193 |
Name | MDM2 |
Synonym | ACTFS|HDMX|hdm2;Mdm2 p53 binding protein homolog (mouse);MDM2;Mdm2 p53 binding protein homolog (mouse) |
Definition | E3 ubiquitin-protein ligase Mdm2|MDM2 variant FB28|MDM2 variant FB30|Mdm2, transformed 3T3 cell double minute 2, p53 binding protein|double minute 2, human homolog of; p53-binding protein|oncoprotein Mdm2 |
Position | 12q14.3-q15 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Sumoylation by RanBP2 regulates transcriptional repression;PID Curated;200097 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Regulation of retinoblastoma protein;PID Curated;200191 |
Pathway | Ubiquitin proteasome pathway;PANTHER;P00060 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144 |
Pathway | cell cycle: g2/m checkpoint;PID BioCarta;100159 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | P53 pathway feedback loops 1;PANTHER;P04392 |
Pathway | tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237 |
Pathway | atm signaling pathway;PID BioCarta;100235 |
Pathway | ctcf: first multivalent nuclear factor;PID BioCarta;100194 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | ErbB4 signaling events;PID Curated;200009 |
Pathway | hypoxia and p53 in the cardiovascular system;PID BioCarta;100084 |
Pathway | Regulation of Androgen receptor activity;PID Curated;200102 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Pathway | Trafficking of AMPA receptors;PID Reactome;500171 |
Pathway | Stabilization of p53;PID Reactome;500316 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Synaptic Transmission;Reactome;REACT:13685 |
Pathway | Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033 |
Pathway | Aurora A signaling;PID Curated;200166 |
Pathway | Cell cycle;KEGG PATHWAY;hsa04110 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | sumoylation by ranbp2 regulates transcriptional repression;PID BioCarta;100053 |
Pathway | AKT phosphorylates targets in the cytosol;PID Reactome;500640 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | Cell Cycle Checkpoints;Reactome;REACT:1538 |
Pathway | p53 pathway;PID Curated;200175 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | liver cancer;GAD |
Disease | Endometrial Neoplasms;GAD |
Disease | Bladder cancer;FunDO |
Disease | breast cancer;GAD |
Disease | Hepatitis C;FunDO |
Disease | Cancer;FunDO |
Disease | bladder cancer;GAD |
Disease | Eating disorder;FunDO |
Disease | Helicobacter Infections;GAD |
Disease | Herpes;FunDO |
Disease | Alveolar rhabdomyosarcoma;KEGG DISEASE;H00037 |
Disease | Accelerated tumor formation, susceptibility to;OMIM |
Disease | Osteosarcoma;KEGG DISEASE;H00036 |
Disease | lung cancer;GAD |
Disease | Breast Neoplasms;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | DNA Damage;GAD |
Disease | Choriocarcinoma;KEGG DISEASE;H00028 |
Disease | Cirrhosis;FunDO |
Disease | Epilepsy;FunDO |
Disease | pregnancy loss;GAD |
Disease | nasopharyngeal cancer;GAD |
Disease | Lung Neoplasms;GAD |
Disease | Adenovirus infection;FunDO |
Disease | Penile cancer;KEGG DISEASE;H00025 |
Disease | CANCER;GAD |
Disease | Leukemia, Lymphocytic, Chronic, B-Cell;GAD |
Disease | Osteosarcoma;GAD |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Endometriosis;FunDO |
Disease | Schistosomiasis;FunDO |
Disease | Cancers of the nervous system;KEGG DISEASE |
Disease | Stomach Neoplasms;GAD |
Disease | REPRODUCTION;GAD |
Disease | Cancers;KEGG DISEASE |
Disease | Glioma;KEGG DISEASE;H00042 |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Cancers of soft tissues and bone;KEGG DISEASE |
Disease | endometrial cancer;GAD |
Disease | colorectal cancer;GAD |
Disease | stomach cancer;GAD |
External Links | |
Links to Entrez Gene | 4193 |
Links to all GeneRIF Items | 4193 |
Links to iHOP | 4193 |
Sequence Information | |
Nucleotide Sequence | >4193 : length: 1494 atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta accacctcacagattccagcttcggaacaagagaccctggttagaccaaagccattgctt ttgaagttattaaagtctgttggtgcacaaaaagacacttatactatgaaagaggttctt ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt gtatattgttcaaatgatcttctaggagatttgtttggcgtgccaagcttctctgtgaaa gagcacaggaaaatatataccatgatctacaggaacttggtagtagtcaatcagcaggaa tcatcggactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat caaaaggaccttgtacaagagcttcaggaagagaaaccttcatcttcacatttggtttct agaccatctacctcatctagaaggagagcaattagtgagacagaagaaaattcagatgaa ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa tctacagggacgccatcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc gactcagaagattatagccttagtgaagaaggacaagaactctcagatgaagatgatgag gtatatcaagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatcccccc cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccagagagtcatgt gttgaggaaaatgatgataaaattacacaagcttcacaatcacaagaaagtgaagactat tctcagccatcaacttctagtagcattatttatagcagccaagaagatgtgaaagagttt gaaagggaagaaacccaagacaaagaagagagtgtggaatctagtttgccccttaatgcc attgaaccttgtgtgatttgtcaaggtcgacctaaaaatggttgcattgtccatggcaaa acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc tgcccagtatgtagacaaccaattcaaatgattgtgctaacttatttcccctag |
Protein Sequence | >4193 : length: 497 MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD WLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEED PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE EGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP CPVCRQPIQMIVLTYFP |