| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 4153 |
Name | MBL2 |
Synonym | COLEC1|HSMBPC|MBL|MBL2D|MBP|MBP-C|MBP1;mannose-binding lectin (protein C) 2, soluble;MBL2;mannose-binding lectin (protein C) 2, soluble |
Definition | collectin-1|mannan-binding lectin|mannose-binding lectin (protein C) 2, soluble (opsonic defect)|mannose-binding lectin 2, soluble (opsonic defect)|mannose-binding protein C |
Position | 10q11.2 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Complement and coagulation cascades;KEGG PATHWAY;hsa04610 |
Pathway | lectin induced complement pathway;PID BioCarta;100118 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Disease | Lupus erythematosus;FunDO |
Disease | Mannose-binding lectin pathway component defects;KEGG DISEASE;H00105 |
Disease | Neurotic disorder;FunDO |
Disease | Premature birth;FunDO |
Disease | Infection;FunDO |
Disease | Lung cancer;FunDO |
Disease | lupus erythematosus;GAD |
Disease | Asthma;FunDO |
Disease | Polyarthritis;FunDO |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | Liver cancer;FunDO |
Disease | Communicable disease;FunDO |
Disease | Macular Degeneration;GAD |
Disease | Dermatitis;FunDO |
Disease | Pancreatitis;FunDO |
Disease | Leprosy;FunDO |
Disease | VISION;GAD |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | meningococcal disease;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | bacterial infection;GAD |
Disease | Meningococcal disease, susceptibility to;OMIM |
Disease | Systemic infection;FunDO |
Disease | Inflammation of the central nervous system;FunDO |
Disease | Cardiovascular Abnormalities;GAD |
Disease | Kidney disease;FunDO |
Disease | systemic lupus erythematosus;GAD |
Disease | SARS (severe acute respiratory syndrome);GAD |
Disease | mannose-binding lectin levels, serum;GAD |
Disease | Autoimmune disease;FunDO |
Disease | METABOLIC;GAD |
Disease | kawasaki disease;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | Thrombocytopenia;FunDO |
Disease | Coronary Artery Disease;GAD |
Disease | Behcet's Disease;GAD |
Disease | Celiac Disease;GAD |
Disease | Gestational diabetes;FunDO |
Disease | Hypertension;FunDO |
Disease | cystic fibrosis;GAD |
Disease | Gestational Diabetes;GAD |
Disease | malaria;GAD |
Disease | Crohn's disease;GAD |
Disease | Preterm delivery, susceptibility to;OMIM |
Disease | Primary immunodeficiency;KEGG DISEASE |
Disease | Aortic valve disease;FunDO |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Chronic infections, due to MBL deficiency;OMIM |
Disease | Mannose-binding protein deficiency;OMIM |
Disease | Cerebral palsy;FunDO |
Disease | Growth retardation;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Enteritis;FunDO |
Disease | Influenza;FunDO |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | early polyarthritis;GAD |
Disease | bronchopulmonary aspergillosis pulmonary aspergillosis;GAD |
Disease | Amyloidosis;FunDO |
Disease | Bacterial vaginosis;FunDO |
Disease | INFECTION;GAD |
Disease | mannose-binding lectin levels;GAD |
Disease | primary biliary cirrhosis;GAD |
Disease | Hyperopia;FunDO |
Disease | Diabetes mellitus, gestational, susceptibility to;OMIM |
Disease | Lupus;GAD |
External Links | |
Links to Entrez Gene | 4153 |
Links to all GeneRIF Items | 4153 |
Links to iHOP | 4153 |
Sequence Information | |
Nucleotide Sequence | >4153 : length: 747 atgtccctgtttccatcactccctctccttctcctgagtatggtggcagcgtcttactca gaaactgtgacctgtgaggatgcccaaaagacctgccctgcagtgattgcctgtagctct ccaggcatcaacggcttcccaggcaaagatgggcgtgatggcaccaagggagaaaagggg gaaccaggccaagggctcagaggcttacagggcccccctggaaagttggggcctccagga aatccagggccttctgggtcaccaggaccaaagggccaaaaaggagaccctggaaaaagt ccggatggtgatagtagcctggctgcctcagaaagaaaagctctgcaaacagaaatggca cgtatcaaaaagtggctcaccttctctctgggcaaacaagttgggaacaagttcttcctg accaatggtgaaataatgacctttgaaaaagtgaaggccttgtgtgtcaagttccaggcc tctgtggccacccccaggaatgctgcagagaatggagccattcagaatctcatcaaggag gaagccttcctgggcatcactgatgagaagacagaagggcagtttgtggatctgacagga aatagactgacctacacaaactggaacgagggtgaacccaacaatgctggttctgatgaa gattgtgtattgctactgaaaaatggccagtggaatgacgtcccctgctccacctcccat ctggccgtctgtgagttccctatctga |
Protein Sequence | >4153 : length: 248 MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH LAVCEFPI |