| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3586 |
Name | IL10 |
Synonym | CSIF|GVHDS|IL-10|IL10A|TGIF;interleukin 10;IL10;interleukin 10 |
Definition | T-cell growth inhibitory factor|cytokine synthesis inhibitory factor|interleukin-10 |
Position | 1q31-q32 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Interleukin signaling pathway;PANTHER;P00036 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Regulation of nuclear SMAD2/3 signaling;PID Curated;200002 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | il-10 anti-inflammatory signaling pathway;PID BioCarta;100134 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Disease | Cachexia;GAD |
Disease | increased interleukin-10 (IL-10) plasma levels;GAD |
Disease | gastric carcinoma;GAD |
Disease | Pulmonary alveolar proteinosis;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | lung transplant complications;GAD |
Disease | Chlamydia;GAD |
Disease | hepatitis C;GAD |
Disease | Influenza;FunDO |
Disease | Sudden infant death syndrome;FunDO |
Disease | Leprosy;FunDO |
Disease | IMMUNE;GAD |
Disease | HEMATOLOGICAL;GAD |
Disease | INFECTION;GAD |
Disease | Cervical cancer;FunDO |
Disease | hepatitis B;GAD |
Disease | H. pylori infection;GAD |
Disease | kawasaki disease;GAD |
Disease | PSYCH;GAD |
Disease | Bronchopulmonary dysplasia;FunDO |
Disease | Fever;GAD |
Disease | hematopoietic stem cell transplantation;GAD |
Disease | Rheumatoid arthritis, progression of;OMIM |
Disease | sudden infant death syndrome;GAD |
Disease | Hypertension;FunDO |
Disease | RENAL;GAD |
Disease | Enteritis;FunDO |
Disease | pneumonia;GAD |
Disease | Osteoporosis;GAD |
Disease | cholesterol cholesterol, HDL cholesterol, LDL cholesterol, VLDL lipoprotein triglycerides;GAD |
Disease | tuberculosis tumor necrosis factor-alpha;GAD |
Disease | gene polymorphism coding for increased IL-10 production;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Epstein-Barr virus infection;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | Irritable Bowel Syndrome;GAD |
Disease | Oral cancer;FunDO |
Disease | kidney disease;GAD |
Disease | Lung cancer;FunDO |
Disease | Stomach Neoplasms;GAD |
Disease | Melanoma;FunDO |
Disease | Sjogrens syndrome;GAD |
Disease | recurrent pregnancy loss;GAD |
Disease | Chagas Cardiomyopathy;GAD |
Disease | Helicobacter infection;FunDO |
Disease | Herpes;FunDO |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Hemolytic anemia;FunDO |
Disease | HIV-1, susceptibility to;OMIM |
Disease | prostate cancer;GAD |
Disease | HIV;GAD |
Disease | Systemic infection;FunDO |
Disease | allograft dysfunction, renal;GAD |
Disease | sepsis;GAD |
Disease | Aortic aneurysm;FunDO |
Disease | diabetes, type 1;GAD |
Disease | HTLV-I infection;FunDO |
Disease | preeclampsia;GAD |
Disease | hepatitis A vaccination, humoral immune response;GAD |
Disease | increased development of adult T-cell leukemia/lymphoma;GAD |
Disease | Hepatitis C, Chronic;GAD |
Disease | reactive arthritis;GAD |
Disease | Seizures, Febrile;GAD |
Disease | Chorioretinitis;GAD |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | allograft outcome;GAD |
Disease | IGA glomerulonephritis;FunDO |
Disease | Abortion;FunDO |
Disease | schizophrenia;GAD |
Disease | chronic obstructive pulmonary disease/COPD;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | Hypogammaglobulinemia;FunDO |
Disease | ulcerative colitis;GAD |
Disease | inflammatory bowel disease/UC;GAD |
Disease | Thyroid cancer;FunDO |
Disease | Sicca syndrome;FunDO |
Disease | small for gestational age;GAD |
Disease | Asthma;FunDO |
Disease | infertility, tubal factor;GAD |
Disease | tacrolimus pharmacokinetics;GAD |
Disease | AGING;GAD |
Disease | Neoplasm metastasis;FunDO |
Disease | prostatic hyperplasia;GAD |
Disease | Prostate cancer;FunDO |
Disease | Anemia;FunDO |
Disease | Infection;FunDO |
Disease | chronic lymphocytic leukaemia;GAD |
Disease | psoriasis;GAD |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | Graft-versus-host disease, protection against;OMIM |
Disease | Dental plaque;FunDO |
Disease | alcoholism;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | aging;GAD |
Disease | METABOLIC;GAD |
Disease | Pre-Eclampsia;FunDO |
Disease | tuberculosis;GAD |
Disease | Toxoplasmosis, Ocular;GAD |
Disease | Ovarian disease;FunDO |
Disease | Pneumococcal septic shock;GAD |
Disease | lupus erythematosus;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Fatty liver;FunDO |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | Fibromyalgia;FunDO |
Disease | Brucellosis;FunDO |
Disease | Esophageal Neoplasms;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Schizophrenia;FunDO |
Disease | Alimentary system disease;FunDO |
Disease | REPRODUCTION;GAD |
Disease | systemic lupus erythematosus;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | Lymphoma;FunDO |
Disease | Obesity;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Non-Hodgkin's B cell lymphoma;GAD |
Disease | kidney transplant complications;GAD |
Disease | stomach cancer;GAD |
Disease | Type 1 diabetes;NHGRI |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Rheumatic fever;FunDO |
Disease | preterm delivery;GAD |
Disease | Periodontitis;FunDO |
Disease | Hepatitis C;FunDO |
Disease | arthritis;GAD |
Disease | Breast cancer;FunDO |
Disease | vascular disease;GAD |
Disease | Parkinson disease;FunDO |
Disease | Embryoma;FunDO |
Disease | Liver Diseases, Alcoholic;GAD |
Disease | Wegener's granulomatosis;GAD |
Disease | GVHD;GAD |
Disease | Cystic fibrosis;FunDO |
Disease | VISION;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | Respiratory failure;FunDO |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | periodontitis;GAD |
Disease | Yersinia infection;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | Behcet's disease;NHGRI |
Disease | Autoimmune disease;FunDO |
Disease | bone density;GAD |
Disease | Adenoma;FunDO |
Disease | heart transplant complications;GAD |
Disease | Disease Models, Animal;GAD |
Disease | herpes zoster;GAD |
Disease | CANCER;GAD |
Disease | Kidney failure;FunDO |
Disease | Bronchial hyperreactivity;FunDO |
Disease | giant cell arteritis;GAD |
Disease | Endometriosis;FunDO |
Disease | Schistosomiasis;FunDO |
Disease | Eosinophilia;GAD |
Disease | cytomegalovirus;GAD |
Disease | type 1 diabetes;GAD |
Disease | Skin cancer;FunDO |
Disease | acute and chronic kidney transplant outcome;GAD |
Disease | Ulcerative colitis;NHGRI |
Disease | Hodgkin's disease;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | renal transplant;GAD |
Disease | Lupus;GAD |
Disease | Metabolic syndrome X;FunDO |
External Links | |
Links to Entrez Gene | 3586 |
Links to all GeneRIF Items | 3586 |
Links to iHOP | 3586 |
Sequence Information | |
Nucleotide Sequence | >3586 : length: 537 atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca ggccagggcacccagtctgagaacagctgcacccacttcccaggcaacctgcctaacatg cttcgagatctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacttgttgttaaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac caagacccagacatcaaggcgcatgtgaactccctgggggagaacctgaagaccctcagg ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacgaaactga |
Protein Sequence | >3586 : length: 178 MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |