| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3458 |
Name | IFNG |
Synonym | IFG|IFI;interferon, gamma;IFNG;interferon, gamma |
Definition | IFN-gamma|immune interferon|interferon gamma |
Position | 12q14 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | ifn gamma signaling pathway;PID BioCarta;100138 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Interferon-gamma signaling pathway;PANTHER;P00035 |
Pathway | IL12 signaling mediated by STAT4;PID Curated;200197 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | PDGFR-alpha signaling pathway;PID Curated;200140 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | Amoebiasis;KEGG PATHWAY;hsa05146 |
Pathway | Calcium signaling in the CD4+ TCR pathway;PID Curated;200159 |
Pathway | IL27-mediated signaling events;PID Curated;200023 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | Regulation of autophagy;KEGG PATHWAY;hsa04140 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Pathway | Malaria;KEGG PATHWAY;hsa05144 |
Pathway | IL2-mediated signaling events;PID Curated;200082 |
Pathway | no2-dependent il-12 pathway in nk cells;PID BioCarta;100093 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Pathway | Proteasome;KEGG PATHWAY;hsa03050 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133 |
Pathway | Chagas disease;KEGG PATHWAY;hsa05142 |
Pathway | Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630 |
Pathway | the 41bb-dependent immune response;PID BioCarta;100257 |
Pathway | IL23-mediated signaling events;PID Curated;200131 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | TGF-beta signaling pathway;KEGG PATHWAY;hsa04350 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | chaperones modulate interferon signaling pathway;PID BioCarta;100016 |
Disease | Sjogren's syndrome;GAD |
Disease | Purpura, Thrombocytopenic, Idiopathic;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | longevity;GAD |
Disease | Influenza;FunDO |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | Alopecia;FunDO |
Disease | aplastic anemia, acquired;GAD |
Disease | Hyperthyroidism;FunDO |
Disease | INFECTION;GAD |
Disease | Colon cancer;FunDO |
Disease | Cervical cancer;FunDO |
Disease | Hepatitis C virus, response to therapy of;OMIM |
Disease | hepatitis B;GAD |
Disease | Common Cold;GAD |
Disease | REPRODUCTION;GAD |
Disease | respiratory syncytial virus bronchiolitis;GAD |
Disease | smoking cessation;GAD |
Disease | RENAL;GAD |
Disease | multiple sclerosis;GAD |
Disease | Enteritis;FunDO |
Disease | Tuberculosis, protection against;OMIM |
Disease | AIDS, rapid progression to;OMIM |
Disease | brucellosis;GAD |
Disease | Atherosclerosis;FunDO |
Disease | Lupus erythematosus;FunDO |
Disease | Atopic asthma;GAD |
Disease | allergic rhinitis;GAD |
Disease | Mycobacterium infection, Atypical;FunDO |
Disease | breast cancer;GAD |
Disease | Graves' disease Hashimoto's thryoiditis;GAD |
Disease | parvovirus B19 infection;GAD |
Disease | Lung cancer;FunDO |
Disease | recurrent pregnancy loss;GAD |
Disease | Aplastic anemia;OMIM |
Disease | Liver cancer;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Helicobacter infection;FunDO |
Disease | Choriocarcinoma;FunDO |
Disease | Communicable disease;FunDO |
Disease | Hemolytic anemia;FunDO |
Disease | Emphysema;FunDO |
Disease | Pancreatitis;FunDO |
Disease | Graves' disease Hashimoto's thyroiditis;GAD |
Disease | Systemic infection;FunDO |
Disease | kidney angiomyolipomas;GAD |
Disease | Neutropenia;FunDO |
Disease | SARS (severe acute respiratory syndrome);GAD |
Disease | sepsis;GAD |
Disease | Vaccinia;FunDO |
Disease | diabetes, type 1;GAD |
Disease | Solid tumor;FunDO |
Disease | graft-versus-host disease;GAD |
Disease | tryptophan catabolism;GAD |
Disease | Behcet syndrome;FunDO |
Disease | Squamous cell cancer;FunDO |
Disease | allograft outcome;GAD |
Disease | IGA glomerulonephritis;FunDO |
Disease | Uveitis;FunDO |
Disease | Abortion;FunDO |
Disease | polymyalgia rheumatica;GAD |
Disease | birth weight perinatal complications;GAD |
Disease | CANCER;GAD |
Disease | Ovarian cancer;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | leishmaniasis, cutaneous;GAD |
Disease | Grave`s disease;GAD |
Disease | Arthritis;FunDO |
Disease | HEMATOLOGICAL;GAD |
Disease | endometriosis;GAD |
Disease | Asthma;FunDO |
Disease | TSC2 angiomyolipomas, renal, modifier of;OMIM |
Disease | AGING;GAD |
Disease | Neoplasm metastasis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Serous cancer;FunDO |
Disease | Anemia;FunDO |
Disease | Infection;FunDO |
Disease | Leukemia;FunDO |
Disease | PHARMACOGENOMIC;GAD |
Disease | METABOLIC;GAD |
Disease | Ulcerative colitis;NHGRI |
Disease | Allograft rejection;KEGG DISEASE;H00083 |
Disease | Pre-Eclampsia;FunDO |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Bronchiectasis;FunDO |
Disease | Bronchiolitis obliterans;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | allergies;GAD |
Disease | Brucellosis;FunDO |
Disease | lung allograft fibrosis;GAD |
Disease | Graft-versus-host disease;KEGG DISEASE;H00084 |
Disease | Virus disease;FunDO |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | Anorexia nervosa;FunDO |
Disease | bronchiolitis obliterans syndrome;GAD |
Disease | hepatitis B, intrauterine;GAD |
Disease | SPT;GAD |
Disease | purpura;GAD |
Disease | Langerhans cell histiocytosis;GAD |
Disease | preterm delivery;GAD |
Disease | Periodontitis;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Breast cancer;FunDO |
Disease | angiomyolipomas, renal;GAD |
Disease | Parkinson disease;FunDO |
Disease | Embryoma;FunDO |
Disease | Fanconi's anemia;FunDO |
Disease | parvovirus;GAD |
Disease | cervical cancer;GAD |
Disease | hepatitis E;GAD |
Disease | nephropathy;GAD |
Disease | Liver disease;FunDO |
Disease | Asthma;GAD |
Disease | Heart Failure;GAD |
Disease | Pancreas cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
Disease | coeliac disease;GAD |
Disease | Intraocular melanoma;FunDO |
Disease | esophageal cancer;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | CHEMDEPENDENCY;GAD |
Disease | Lichen planus;FunDO |
Disease | Celiac Disease;GAD |
Disease | Childhood atopic asthma;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Familial Mediterranean fever;FunDO |
Disease | cirrhosis hepatitis C, chronic;GAD |
Disease | giant cell arteritis;GAD |
Disease | Endometriosis;FunDO |
Disease | ulcerative colitis;GAD |
Disease | Dermatitis;FunDO |
Disease | Pelvic inflammatory disease;FunDO |
Disease | lung function;GAD |
Disease | acute and chronic kidney transplant outcome;GAD |
Disease | Angiomyolipoma;FunDO |
Disease | renal transplant;GAD |
External Links | |
Links to Entrez Gene | 3458 |
Links to all GeneRIF Items | 3458 |
Links to iHOP | 3458 |
Sequence Information | |
Nucleotide Sequence | >3458 : length: 501 atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg gctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcga ggtcgaagagcatcccagtaa |
Protein Sequence | >3458 : length: 166 MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |