| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 345 |
Name | APOC3 |
Synonym | APOCIII|HALP2;apolipoprotein C-III;APOC3;apolipoprotein C-III |
Definition | apo-CIII|apoC-III|apolipoprotein C3 |
Position | 11q23.1-q23.2 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | PPAR signaling pathway;KEGG PATHWAY;hsa03320 |
Pathway | Lipoprotein metabolism;PID Reactome;500795 |
Pathway | Chylomicron-mediated lipid transport;PID Reactome;500796 |
Pathway | Metabolism of lipids and lipoproteins;Reactome;REACT:22258 |
Pathway | HDL-mediated lipid transport;PID Reactome;500797 |
Disease | hyperlipidemia;GAD |
Disease | Lupus erythematosus;FunDO |
Disease | metabolism disorders;GAD |
Disease | obesity;GAD |
Disease | hypertension, pregnancy induced preeclampsia;GAD |
Disease | Alzheimer's disease;GAD |
Disease | triglycerides;GAD |
Disease | LDL cholesterol;GAD |
Disease | cholesterol, HDL;GAD |
Disease | hypertension;GAD |
Disease | cholesterol, total;GAD |
Disease | lipid metabolism disorders;GAD |
Disease | Cholelithiasis;FunDO |
Disease | Liver cancer;FunDO |
Disease | AGING;GAD |
Disease | longevity;GAD |
Disease | increased number of circulating VLDL and IDL particles;GAD |
Disease | nephropathy, diabetic;GAD |
Disease | atherosclerosis, coronary;GAD |
Disease | IMMUNE;GAD |
Disease | familial combined hyperlipidemia;GAD |
Disease | PHARMACOGENOMIC;GAD |
Disease | apoB;GAD |
Disease | METABOLIC;GAD |
Disease | dyslipemia;GAD |
Disease | Plasma Lipid Levels;GAD |
Disease | Drug abuse;FunDO |
Disease | lipoprotein;GAD |
Disease | diabetes, type 2;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | lipoprotein, LDL;GAD |
Disease | cholesterol, HDL triglycerides;GAD |
Disease | apoA1;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | insulin sensitivity;GAD |
Disease | cardiovascular risk;GAD |
Disease | cerebrovascular disease;GAD |
Disease | atherosclerosis, coronary lipoprotein triglycerides;GAD |
Disease | gallstones;GAD |
Disease | HDL cholesterol;GAD |
Disease | diverse hyperlipidaemic phenotypes;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | lipids triglycerides;GAD |
Disease | cholesterol cholesterol, HDL cholesterol, LDL lipoprotein triglycerides;GAD |
Disease | Hyperglycemia;FunDO |
Disease | Hypertension;FunDO |
Disease | blood pressure, arterial;GAD |
Disease | cholesterol, LDL;GAD |
Disease | cholesterol;GAD |
Disease | Hyperlipidemia;FunDO |
Disease | RENAL;GAD |
Disease | Liver tumor;FunDO |
Disease | Apolipoprotein C3 deficiency;OMIM |
Disease | Transient hypertension of pregnancy;FunDO |
Disease | triacylglycerol;GAD |
Disease | atherosclerosis, generalized;GAD |
Disease | metabolic syndrome;GAD |
Disease | atherosclerosis, carotid;GAD |
Disease | Atherosclerosis;GAD |
Disease | Hypertriglyceridemia;GAD |
Disease | Atherosclerosis;FunDO |
Disease | variation in plasma lipoproteins;GAD |
Disease | Metabolic syndrome X;FunDO |
External Links | |
Links to Entrez Gene | 345 |
Links to all GeneRIF Items | 345 |
Links to iHOP | 345 |
Sequence Information | |
Nucleotide Sequence | >345 : length: 300 atgcagccccgggtactccttgttgttgccctcctggcgctcctggcctctgcccgagct tcagaggccgaggatgcctcccttctcagcttcatgcagggttacatgaagcacgccacc aagaccgccaaggatgcactgagcagcgtgcaggagtcccaggtggcccagcaggccagg ggctgggtgaccgatggcttcagttccctgaaagactactggagcaccgttaaggacaag ttctctgagttctgggatttggaccctgaggtcagaccaacttcagccgtggctgcctga |
Protein Sequence | >345 : length: 99 MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |