| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 332 |
Name | BIRC5 |
Synonym | API4|EPR-1;baculoviral IAP repeat containing 5;BIRC5;baculoviral IAP repeat containing 5 |
Definition | apoptosis inhibitor 4|apoptosis inhibitor survivin|baculoviral IAP repeat-containing protein 5|survivin variant 3 alpha |
Position | 17q25 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | b cell survival pathway;PID BioCarta;100228 |
Pathway | Validated targets of C-MYC transcriptional activation;PID Curated;200045 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | Aurora B signaling;PID Curated;200010 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | Aurora A signaling;PID Curated;200166 |
Pathway | FOXM1 transcription factor network;PID Curated;200120 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Colorectal cancer;KEGG PATHWAY;hsa05210 |
Pathway | DNA Replication;Reactome;REACT:383 |
Disease | Eosinophilia;FunDO |
Disease | Epstein-Barr virus infection;FunDO |
Disease | Testicular dysfunction;FunDO |
Disease | Rheumatoid arthritis;FunDO |
Disease | Adenovirus infection;FunDO |
Disease | Corneal disease;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | Cancer;FunDO |
Disease | Infertility;FunDO |
Disease | Parasitic disease;FunDO |
Disease | Endometriosis;FunDO |
Disease | HIV infection;FunDO |
Disease | Leukoencephalopathy;FunDO |
Disease | Arthritis;FunDO |
External Links | |
Links to Entrez Gene | 332 |
Links to all GeneRIF Items | 332 |
Links to iHOP | 332 |
Sequence Information | |
Nucleotide Sequence | >332 : length: 414 atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc ttcaaggagctggaaggctgggagccagatgacgaccccatgcaaaggaaaccaacaata agaagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctg ccatggattgaggcctctggccggagctgcctggtcccagagtggctgcaccacttccag ggtttattccctggtgccaccagccttcctgtgggccccttagcaatgtcttag |
Protein Sequence | >332 : length: 137 MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC FKELEGWEPDDDPMQRKPTIRRKNLRKLRRKCAVPSSSWLPWIEASGRSCLVPEWLHHFQ GLFPGATSLPVGPLAMS |