| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3117 |
Name | HLA-DQA1 |
Synonym | CD|CELIAC1|DQ-A1|GSE|HLA-DQA;major histocompatibility complex, class II, DQ alpha 1;HLA-DQA1;major histocompatibility complex, class II, DQ alpha 1 |
Definition | DC-1 alpha chain|DC-alpha|HLA class II histocompatibility antigen, DQ alpha 1 chain|HLA class II histocompatibility antigen, DQ(W3) alpha chain|HLA-DCA|MHC HLA-DQ alpha|MHC class II DQA1|MHC class II HLA-D alpha glycoprotein|MHC class II HLA-DQ-alpha-1|MH |
Position | 6p21.3 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Asthma;KEGG PATHWAY;hsa05310 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | T cell activation;PANTHER;P00053 |
Pathway | Staphylococcus aureus infection;KEGG PATHWAY;hsa05150 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Systemic lupus erythematosus;KEGG PATHWAY;hsa05322 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | Leishmaniasis;KEGG PATHWAY;hsa05140 |
Pathway | Toxoplasmosis;KEGG PATHWAY;hsa05145 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Pathway | Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672 |
Disease | inflammatory bowel disease;GAD |
Disease | Schizophrenia;NHGRI |
Disease | Diabetes;KEGG DISEASE |
Disease | pemphigoid, bullous;GAD |
Disease | IMMUNE;GAD |
Disease | endometriosis;GAD |
Disease | Alopecia;FunDO |
Disease | Cardiac diseases;KEGG DISEASE |
Disease | INFECTION;GAD |
Disease | cirrhosis, biliary primary;GAD |
Disease | PSYCH;GAD |
Disease | Celiac disease;NHGRI |
Disease | juvenile dermatomyositis;GAD |
Disease | Celiac disease, susceptibility to;OMIM |
Disease | multiple sclerosis;GAD |
Disease | Systemic lupus erythematosus;NHGRI |
Disease | cytomegalovirus retinitis;GAD |
Disease | carbamazepine hypersensitivity;GAD |
Disease | pregnancy loss, recurrent;GAD |
Disease | allergic rhinitis;GAD |
Disease | Primary biliary cirrhosis;FunDO |
Disease | autoimmune response;GAD |
Disease | Graves' disease;GAD |
Disease | HLA-DQA1 differential expression;GAD |
Disease | kidney cancer;GAD |
Disease | Liver cancer;FunDO |
Disease | inflammatory myopathies;GAD |
Disease | hypertension;GAD |
Disease | sclerosis, systemic;GAD |
Disease | HIV;GAD |
Disease | Aortic aneurysm;FunDO |
Disease | diabetes, type 1;GAD |
Disease | myasthenia gravis;GAD |
Disease | Systemic lupus erythematosus;KEGG DISEASE;H00080 |
Disease | Rheumatoid arthritis;NHGRI |
Disease | allergy;GAD |
Disease | autoimmune polyglandular syndrome;GAD |
Disease | measles antibody level;GAD |
Disease | thyroid autoimmunity;GAD |
Disease | vitiligo;GAD |
Disease | Type I diabetes mellitus;KEGG DISEASE;H00408 |
Disease | Ovarian cancer;FunDO |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | adenomyosis;GAD |
Disease | ulcerative colitis;GAD |
Disease | Common wart;FunDO |
Disease | Asthma;FunDO |
Disease | Arthritis, Rheumatoid;GAD |
Disease | infertility, tubal factor;GAD |
Disease | osteoarthritis;GAD |
Disease | Graves' disease;KEGG DISEASE;H00082 |
Disease | psoriasis;GAD |
Disease | METABOLIC;GAD |
Disease | rheumatoid arthritis;GAD |
Disease | systemic lupus erythematosus;GAD |
Disease | Hashimoto's thyroiditis;KEGG DISEASE;H00081 |
Disease | Retinal disease;FunDO |
Disease | tuberculosis;GAD |
Disease | diabetes, type 2;GAD |
Disease | Tuberculosis;FunDO |
Disease | warts;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | nasal polyposis;GAD |
Disease | Dilated cardiomyopathy (DCM);KEGG DISEASE;H00294 |
Disease | stroke, lacunar;GAD |
Disease | REPRODUCTION;GAD |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Celiac disease;FunDO |
Disease | ovarian cancer;GAD |
Disease | stomach cancer;GAD |
Disease | Rheumatic fever;FunDO |
Disease | blood group incompatibility;GAD |
Disease | schizophrenia;GAD |
Disease | Graves disease;GAD |
Disease | Hepatitis B, Chronic;GAD |
Disease | Breast cancer;FunDO |
Disease | Stomach cancer;FunDO |
Disease | hepatitis B;GAD |
Disease | Circulatory system diseases;KEGG DISEASE |
Disease | Inflammatory bowel disease;NHGRI |
Disease | cervical cancer;GAD |
Disease | atherothrombotic brain infarction;GAD |
Disease | H. pylori infection;GAD |
Disease | Aplastic anemia;FunDO |
Disease | Asthma;GAD |
Disease | Yersinia infection;FunDO |
Disease | Autoimmune disease;FunDO |
Disease | cholangitis, sclerosing;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | Vogt-Koyanagi-Harada syndrome;GAD |
Disease | Celiac Disease;GAD |
Disease | CANCER;GAD |
Disease | cardiomyopathy;GAD |
External Links | |
Links to Entrez Gene | 3117 |
Links to all GeneRIF Items | 3117 |
Links to iHOP | 3117 |
Sequence Information | |
Nucleotide Sequence | >3117 : length: 768 atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga |
Protein Sequence | >3117 : length: 255 MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII QGLRSVGASRHQGPL |