| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 3105 |
Name | HLA-A |
Synonym | HLAA;major histocompatibility complex, class I, A;HLA-A;major histocompatibility complex, class I, A |
Definition | HLA class I histocompatibility antigen, A-1 alpha chain|MHC class I antigen HLA-A heavy chain|antigen presenting molecule|leukocyte antigen class I-A |
Position | 6p21.3 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Antigen processing and presentation;KEGG PATHWAY;hsa04612 |
Pathway | Type I diabetes mellitus;KEGG PATHWAY;hsa04940 |
Pathway | Allograft rejection;KEGG PATHWAY;hsa05330 |
Pathway | Viral myocarditis;KEGG PATHWAY;hsa05416 |
Pathway | ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095 |
Pathway | antigen processing and presentation;PID BioCarta;100107 |
Pathway | Downstream signaling in naive CD8+ T cells;PID Curated;200184 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514 |
Pathway | Graft-versus-host disease;KEGG PATHWAY;hsa05332 |
Pathway | TCR signaling in naive CD8+ T cells;PID Curated;200062 |
Pathway | IL12-mediated signaling events;PID Curated;200034 |
Pathway | AP-1 transcription factor network;PID Curated;200118 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Phagosome;KEGG PATHWAY;hsa04145 |
Pathway | Autoimmune thyroid disease;KEGG PATHWAY;hsa05320 |
Disease | Lupus erythematosus;FunDO |
Disease | Vitiligo;NHGRI |
Disease | pulmonary hypertension;GAD |
Disease | ANCA positive patients;GAD |
Disease | Sjogren's syndrome;GAD |
Disease | endometriosis;GAD |
Disease | graft-versus-host disease;GAD |
Disease | Nasopharyngeal carcinoma;NHGRI |
Disease | Severe cutaneous adverse reaction, susceptibiliyt to;OMIM |
Disease | Bladder cancer;FunDO |
Disease | Periodontitis;FunDO |
Disease | thrombosis, deep vein;GAD |
Disease | Melanoma;FunDO |
Disease | pancreatitis, chronic calcifying;GAD |
Disease | Psoriasis;FunDO |
Disease | Nasopharyngeal cancer;FunDO |
Disease | AGING;GAD |
Disease | Liver cancer;FunDO |
Disease | HIV infection;FunDO |
Disease | Henoch-Schoenlein purpura;FunDO |
Disease | Takayasu's arteritis;FunDO |
Disease | Herpes;FunDO |
Disease | Embryoma;FunDO |
Disease | Mucocutaneous lymph node syndrome;FunDO |
Disease | Enterovirus Infections;GAD |
Disease | age;GAD |
Disease | Prostate cancer;FunDO |
Disease | leukemia;GAD |
Disease | Leprosy;FunDO |
Disease | IMMUNE;GAD |
Disease | Multiple myeloma;FunDO |
Disease | Alopecia;FunDO |
Disease | Ulcerative colitis;FunDO |
Disease | Endometriosis;FunDO |
Disease | Leukemia;FunDO |
Disease | HIV;GAD |
Disease | alopecia areata;GAD |
Disease | periodontitis;GAD |
Disease | Schizophrenia;FunDO |
Disease | nasopharyngeal carcinoma;GAD |
Disease | Colon cancer;FunDO |
Disease | Cervical cancer;FunDO |
Disease | Alzheimer's disease;GAD |
Disease | Dermatitis, Atopic;GAD |
Disease | Primary biliary cirrhosis;FunDO |
Disease | psoriasis;GAD |
Disease | Spondylarthropathies;GAD |
Disease | PSYCH;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | diabetes, type 1;GAD |
Disease | nasopharyngeal cancer;GAD |
Disease | pancreatitis, autoimmune;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | Multiple sclerosis;FunDO |
Disease | Pancreas cancer;FunDO |
Disease | Autoimmune thyroiditis;FunDO |
Disease | hepatitis, fulminant non-A, nonB;GAD |
Disease | Meningioma;FunDO |
Disease | Hepatitis C, Chronic;GAD |
Disease | HIV-1 control;GAD |
Disease | prostate cancer;GAD |
Disease | Graves' disease;FunDO |
Disease | INFECTION;GAD |
Disease | NEUROLOGICAL;GAD |
Disease | REPRODUCTION;GAD |
Disease | Autistic disorder;FunDO |
Disease | Hepatitis B;FunDO |
Disease | IGA glomerulonephritis;FunDO |
Disease | multiple sclerosis;GAD |
Disease | Abortion;FunDO |
Disease | vitiligo;GAD |
Disease | CANCER;GAD |
Disease | schizophrenia;GAD |
Disease | pulmonary thromboembolism;GAD |
Disease | Severe acute respiratory syndrome;FunDO |
Disease | Hodgkin's disease;FunDO |
Disease | Ankylosing spondylitis;FunDO |
External Links | |
Links to Entrez Gene | 3105 |
Links to all GeneRIF Items | 3105 |
Links to iHOP | 3105 |
Sequence Information | |
Nucleotide Sequence | >3105 : length: 1098 atggccgtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc cagacctgggcgggctcccactccatgaggtatttcttcacatccgtgtcccggcccggc cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc gacagcgacgccgcgagccagaggatggagccgcgggcgccgtggatagagcaggagggg ccggagtattgggaccaggagacacggaatgtgaaggcccagtcacagactgaccgagtg gacctggggaccctgcgcggctactacaaccagagcgaggccggttctcacaccatccag ataatgtatggctgcgacgtggggtcggacgggcgcttcctccgcgggtaccggcaggac gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg gacatggcggctcagatcaccaagcgcaagtgggaggcggcccatgaggcggagcagttg agagcctacctggatggcacgtgcgtggagtggctccgcagatacctggagaacgggaag gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga tacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagctg tcttcccagcccaccatccccatcgtgggcatcattgctggcctggttctccttggagct gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa ggagggagttacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtccctc acagcttgtaaagtgtga |
Protein Sequence | >3105 : length: 365 MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF DSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQ IMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQL RAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL TACKV |