| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 154 |
Name | ADRB2 |
Synonym | ADRB2R|ADRBR|B2AR|BAR|BETA2AR;adrenergic, beta-2-, receptor, surface;ADRB2;adrenergic, beta-2-, receptor, surface |
Definition | beta-2 adrenergic receptor|beta-2 adrenoceptor|beta-2 adrenoreceptor|catecholamine receptor |
Position | 5q31-q32 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | beta-arrestins in gpcr desensitization;PID BioCarta;100231 |
Pathway | Beta2 adrenergic receptor signaling pathway;PANTHER;P04378 |
Pathway | Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080 |
Pathway | Arf6 trafficking events;PID Curated;200046 |
Pathway | phospholipase c-epsilon pathway;PID BioCarta;100070 |
Pathway | Arf6 signaling events;PID Curated;200060 |
Pathway | corticosteroids and cardioprotection;PID BioCarta;100156 |
Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway;PANTHER;P00026 |
Pathway | Calcium signaling pathway;KEGG PATHWAY;hsa04020 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Salivary secretion;KEGG PATHWAY;hsa04970 |
Pathway | cystic fibrosis transmembrane conductance regulator (cftr) and beta 2 adrenergic receptor (b2ar) pathway;PID BioCarta;100205 |
Disease | BHR;GAD |
Disease | respiratory airway resistance;GAD |
Disease | interstitial cystitis;GAD |
Disease | Body Weight;GAD |
Disease | Premature birth;FunDO |
Disease | breast cancer;GAD |
Disease | Parasitic infection;GAD |
Disease | Lung cancer;FunDO |
Disease | Obesity, susceptibility to;OMIM |
Disease | High total IgE;GAD |
Disease | obesity;GAD |
Disease | Diabetes mellitus;FunDO |
Disease | AGING;GAD |
Disease | Beta-2-adrenoreceptor agonist, reduced response to;OMIM |
Disease | Sickle cell disease;FunDO |
Disease | Glaucoma;FunDO |
Disease | preterm delivery;GAD |
Disease | Steroid-requiring asthma in sedentary women;GAD |
Disease | DEVELOPMENTAL;GAD |
Disease | hypertension;GAD |
Disease | Dermatitis;FunDO |
Disease | Prostate cancer;FunDO |
Disease | Cystic fibrosis;FunDO |
Disease | IMMUNE;GAD |
Disease | limb deficiency anomalies;GAD |
Disease | Asthma smokers;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | attention deficit hyperactivity disorder;GAD |
Disease | Subarachnoid hemorrhage;FunDO |
Disease | colorectal cancer;GAD |
Disease | Polycystic ovary syndrome;FunDO |
Disease | hypertriglyceridemia and the development of fatty liver;GAD |
Disease | Asthma;GAD |
Disease | METABOLIC;GAD |
Disease | PEF;GAD |
Disease | epinephrine lung function norepinephrine;GAD |
Disease | INFECTION;GAD |
Disease | Autistic disorder;FunDO |
Disease | pulmonary function;GAD |
Disease | Bronchial disease;FunDO |
Disease | Drug abuse;FunDO |
Disease | subcutaneous fat accumulation;GAD |
Disease | diabetes, type 2;GAD |
Disease | PSYCH;GAD |
Disease | Asthma;KEGG DISEASE;H00079 |
Disease | Heart Failure;GAD |
Disease | metabolic syndrome;GAD |
Disease | REPRODUCTION;GAD |
Disease | CARDIOVASCULAR;GAD |
Disease | persistent bronchial hyperresponsiveness;GAD |
Disease | CANCER;GAD |
Disease | blood pressure, arterial;GAD |
Disease | Malaria;FunDO |
Disease | Decreased airway responsiveness;GAD |
Disease | Weight Gain;GAD |
Disease | Graves' disease;FunDO |
Disease | Asthma, nocturnal, susceptibility to;OMIM |
Disease | FEV1;GAD |
Disease | Chronic obstructive airway disease;FunDO |
Disease | Asthma severity;GAD |
Disease | Hypertension;FunDO |
Disease | Heart failure;FunDO |
Disease | cholesterol, LDL;GAD |
Disease | Myopathy;FunDO |
Disease | Obesity and Type 2 Diabetes;GAD |
Disease | flow-mediated dilatation of the brachial artery;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Obesity;FunDO |
Disease | heart rate;GAD |
Disease | increased body weight and dyslipoproteinaemia involving triglyceride-rich lipoproteins;GAD |
Disease | cardiomyopathy;GAD |
Disease | Allergies and autoimmune diseases;KEGG DISEASE |
Disease | human intelligence;GAD |
Disease | multiple sclerosis;GAD |
Disease | Metabolism disease;FunDO |
Disease | Arthritis;FunDO |
Disease | Nocturnal asthma;GAD |
Disease | Bronchial asthma;GAD |
Disease | Atherosclerosis;FunDO |
External Links | |
Links to Entrez Gene | 154 |
Links to all GeneRIF Items | 154 |
Links to iHOP | 154 |
Sequence Information | |
Nucleotide Sequence | >154 : length: 1242 atggggcaacccgggaacggcagcgccttcttgctggcacccaatagaagccatgcgccg gaccacgacgtcacgcagcaaagggacgaggtgtgggtggtgggcatgggcatcgtcatg tctctcatcgtcctggccatcgtgtttggcaatgtgctggtcatcacagccattgccaag ttcgagcgtctgcagacggtcaccaactacttcatcacttcactggcctgtgctgatctg gtcatgggcctggcagtggtgccctttggggccgcccatattcttatgaaaatgtggact tttggcaacttctggtgcgagttttggacttccattgatgtgctgtgcgtcacggccagc attgagaccctgtgcgtgatcgcagtggatcgctactttgccattacttcacctttcaag taccagagcctgctgaccaagaataaggcccgggtgatcattctgatggtgtggattgtg tcaggccttacctccttcttgcccattcagatgcactggtaccgggccacccaccaggaa gccatcaactgctatgccaatgagacctgctgtgacttcttcacgaaccaagcctatgcc attgcctcttccatcgtgtccttctacgttcccctggtgatcatggtcttcgtctactcc agggtctttcaggaggccaaaaggcagctccagaagattgacaaatctgagggccgcttc catgtccagaaccttagccaggtggagcaggatgggcggacggggcatggactccgcaga tcttccaagttctgcttgaaggagcacaaagccctcaagacgttaggcatcatcatgggc actttcaccctctgctggctgcccttcttcatcgttaacattgtgcatgtgatccaggat aacctcatccgtaaggaagtttacatcctcctaaattggataggctatgtcaattctggt ttcaatccccttatctactgccggagcccagatttcaggattgccttccaggagcttctg tgcctgcgcaggtcttctttgaaggcctatgggaatggctactccagcaacggcaacaca ggggagcagagtggatatcacgtggaacaggagaaagaaaataaactgctgtgtgaagac ctcccaggcacggaagactttgtgggccatcaaggtactgtgcctagcgataacattgat tcacaagggaggaattgtagtacaaatgactcactgctgtaa |
Protein Sequence | >154 : length: 413 MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL |