| General information | Literature | Expression | Regulation | Variant | Interaction |
Basic Information | |
|---|---|
Gene ID | 11065 |
Name | UBE2C |
Synonym | UBCH10|dJ447F3.2;ubiquitin-conjugating enzyme E2C;UBE2C;ubiquitin-conjugating enzyme E2C |
Definition | cyclin-selective ubiquitin carrier protein|mitotic-specific ubiquitin-conjugating enzyme|ubiquitin carrier protein C|ubiquitin carrier protein E2-C|ubiquitin-conjugating enzyme E2 C|ubiquitin-protein ligase C |
Position | 20q13.12 |
Gene Type | protein-coding |
Pathways and Diseases | |
Pathway | Autodegradation of Cdh1 by Cdh1:APC/C;PID Reactome;500401 |
Pathway | Ubiquitin proteasome pathway;PANTHER;P00060 |
Pathway | Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120 |
Pathway | APC-Cdc20 mediated degradation of Nek2A;Reactome;REACT:8017 |
Pathway | Cell Cycle Checkpoints;Reactome;REACT:1538 |
Pathway | Cdc20:Phospho-APC/C mediated degradation of Cyclin A;Reactome;REACT:6850 |
Pathway | Regulation of APC/C activators between G1/S and early anaphase;PID Reactome;500391 |
Pathway | Cell Cycle, Mitotic;Reactome;REACT:152 |
Pathway | APC/C-mediated degradation of cell cycle proteins;PID Reactome;500390 |
Pathway | Phosphorylation of the APC/C;PID Reactome;500395 |
Disease | Cancer;FunDO |
External Links | |
Links to Entrez Gene | 11065 |
Links to all GeneRIF Items | 11065 |
Links to iHOP | 11065 |
Sequence Information | |
Nucleotide Sequence | >11065 : length: 540 atggcttcccaaaaccgcgacccagccgccactagcgtcgccgccgcccgtaaaggagct gagccgagcgggggcgccgcccggggtccggtgggcaaaaggctacagcaggagctgatg accctcatgatgtctggcgataaagggatttctgccttccctgaatcagacaaccttttc aaatgggtagggaccatccatggagcagctggaacagtatatgaagacctgaggtataag ctctcgctagagttccccagtggctacccttacaatgcgcccacagtgaagttcctcacg ccctgctatcaccccaacgtggacacccagggtaacatatgcctggacatcctgaaggaa aagtggtctgccctgtatgatgtcaggaccattctgctctccatccagagccttctagga gaacccaacattgatagtcccttgaacacacatgctgccgagctctggaaaaaccccaca gcttttaagaagtacctgcaagaaacctactcaaagcaggtcaccagccaggagccctga |
Protein Sequence | >11065 : length: 179 MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |