| Gene ID | 3265 |
| Symbol | HRAS |
| Synonymous | C-BAS/HAS|C-H-RAS|C-HA-RAS1|CTLO|H-RASIDX|HAMSV|HRAS1|RASH1|p21ras |
| Full name | Harvey rat sarcoma viral oncogene homolog |
| Gene description | GTP- and GDP-binding peptide B|GTPase HRas|Ha-Ras1 proto-oncoprotein|Harvey rat sarcoma viral oncoprotein|Ras family small GTP binding protein H-Ras|c-has/bas p21 protein|c-ras-Ki-2 activated oncogene|p19 H-RasIDX protein|transformation gene: oncogene HAM |
| Cytoband | 11p15.5 |
| Gene type | protein-coding |
| Synonymous | MIM:190020; HGNC:HGNC:5173; Ensembl:ENSG00000174775; HPRD:01813; Vega:OTTHUMG00000131919 |
Pathways and Diseases | Detail |
|---|---|
Pathway | il-2 receptor beta chain in t cell activation;PID BioCarta;100129 |
Pathway | role of erbb2 in signal transduction and oncology;PID BioCarta;100147 |
Pathway | Signaling by Insulin receptor;Reactome;REACT:498 |
Pathway | Axon guidance;Reactome;REACT:18266 |
Pathway | MAPK signaling pathway;KEGG PATHWAY;hsa04010 |
Pathway | Endometrial cancer;KEGG PATHWAY;hsa05213 |
Pathway | insulin signaling pathway;PID BioCarta;100124 |
Pathway | TGF-beta signaling pathway;PANTHER;P00052 |
Pathway | pdgf signaling pathway;PID BioCarta;100077 |
Pathway | PDGFR-beta signaling pathway;PID Curated;200127 |
Pathway | sprouty regulation of tyrosine kinase signals;PID BioCarta;100029 |
Pathway | FGF signaling pathway;PANTHER;P00021 |
Pathway | Melanogenesis;KEGG PATHWAY;hsa04916 |
Pathway | Signaling by EGFR;Reactome;REACT:9417 |
Pathway | EPHB forward signaling;PID Curated;200041 |
Pathway | PDGF signaling pathway;PANTHER;P00047 |
Pathway | egf signaling pathway;PID BioCarta;100181 |
Pathway | aspirin blocks signaling pathway involved in platelet activation;PID BioCarta;100030 |
Pathway | EGF receptor signaling pathway;PANTHER;P00018 |
Pathway | regulation of splicing through sam68;PID BioCarta;100036 |
Pathway | inhibition of cellular proliferation by gleevec;PID BioCarta;100154 |
Pathway | Endothelins;PID Curated;200004 |
Pathway | Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664 |
Pathway | how progesterone initiates the oocyte maturation;PID BioCarta;100104 |
Pathway | bcr signaling pathway;PID BioCarta;100227 |
Pathway | erk1/erk2 mapk signaling pathway;PID BioCarta;100170 |
Pathway | Bladder cancer;KEGG PATHWAY;hsa05219 |
Pathway | nfat and hypertrophy of the heart ;PID BioCarta;100098 |
Pathway | ccr3 signaling in eosinophils;PID BioCarta;100215 |
Pathway | tpo signaling pathway;PID BioCarta;100012 |
Pathway | mcalpain and friends in cell motility;PID BioCarta;100111 |
Pathway | Long-term depression;KEGG PATHWAY;hsa04730 |
Pathway | p53 pathway feedback loops 2;PANTHER;P04398 |
Pathway | trka receptor signaling pathway;PID BioCarta;100011 |
Pathway | role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221 |
Pathway | Syndecan-2-mediated signaling events;PID Curated;200164 |
Pathway | multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135 |
Pathway | signaling pathway from g-protein families;PID BioCarta;100153 |
Pathway | Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161 |
Pathway | BCR signaling pathway;PID Curated;200005 |
Pathway | Signaling by PDGF;Reactome;REACT:16888 |
Pathway | mapkinase signaling pathway;PID BioCarta;100113 |
Pathway | EGFR-dependent Endothelin signaling events;PID Curated;200095 |
Pathway | epo signaling pathway;PID BioCarta;100175 |
Pathway | mets affect on macrophage differentiation;PID BioCarta;100169 |
Pathway | B cell activation;PANTHER;P00010 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | melanocyte development and pigmentation pathway;PID BioCarta;100108 |
Pathway | Angiogenesis;PANTHER;P00005 |
Pathway | phospholipids as signalling intermediaries;PID BioCarta;100183 |
Pathway | IGF1 pathway;PID Curated;200084 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Thyroid cancer;KEGG PATHWAY;hsa05216 |
Pathway | Melanoma;KEGG PATHWAY;hsa05218 |
Pathway | Glioma;KEGG PATHWAY;hsa05214 |
Pathway | influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054 |
Pathway | B cell receptor signaling pathway;KEGG PATHWAY;hsa04662 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810 |
Pathway | fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162 |
Pathway | trefoil factors initiate mucosal healing;PID BioCarta;100018 |
Pathway | a6b1 and a6b4 Integrin signaling;PID Curated;200162 |
Pathway | Ras activation uopn Ca2+ infux through NMDA receptor;PID Reactome;500178 |
Pathway | T cell receptor signaling pathway;KEGG PATHWAY;hsa04660 |
Pathway | Axon guidance;KEGG PATHWAY;hsa04360 |
Pathway | Nongenotropic Androgen signaling;PID Curated;200145 |
Pathway | transcription factor creb and its extracellular signals;PID BioCarta;100198 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | CDC42 signaling events;PID Curated;200057 |
Pathway | Insulin Pathway;PID Curated;200012 |
Pathway | bioactive peptide induced signaling pathway;PID BioCarta;100226 |
Pathway | Long-term potentiation;KEGG PATHWAY;hsa04720 |
Pathway | CREB phophorylation through the activation of Ras;PID Reactome;500177 |
Pathway | keratinocyte differentiation;PID BioCarta;100119 |
Pathway | Synaptic Transmission;Reactome;REACT:13685 |
Pathway | angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236 |
Pathway | Integrin signalling pathway;PANTHER;P00034 |
Pathway | ras signaling pathway;PID BioCarta;100047 |
Pathway | Renal cell carcinoma;KEGG PATHWAY;hsa05211 |
Pathway | cxcr4 signaling pathway;PID BioCarta;100192 |
Pathway | nerve growth factor pathway (ngf);PID BioCarta;100096 |
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | role of mal in rho-mediated activation of srf;PID BioCarta;100114 |
Pathway | vegf hypoxia and angiogenesis;PID BioCarta;100006 |
Pathway | phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210 |
Pathway | Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156 |
Pathway | Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650 |
Pathway | Endocytosis;KEGG PATHWAY;hsa04144 |
Pathway | Signaling in Immune system;Reactome;REACT:6900 |
Pathway | Signaling events regulated by Ret tyrosine kinase;PID Curated;200058 |
Pathway | igf-1 signaling pathway;PID BioCarta;100136 |
Pathway | Fc-epsilon receptor I signaling in mast cells;PID Curated;200003 |
Pathway | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032 |
Pathway | LPA receptor mediated events;PID Curated;200011 |
Pathway | calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150 |
Pathway | il 3 signaling pathway;PID BioCarta;100128 |
Pathway | Focal adhesion;KEGG PATHWAY;hsa04510 |
Pathway | Chronic myeloid leukemia;KEGG PATHWAY;hsa05220 |
Pathway | EPO signaling pathway;PID Curated;200157 |
Pathway | T cell activation;PANTHER;P00053 |
Pathway | role of erk5 in neuronal survival pathway;PID BioCarta;100171 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | PI3 kinase pathway;PANTHER;P00048 |
Pathway | map kinase inactivation of smrt corepressor;PID BioCarta;100032 |
Pathway | roles of beta arrestin dependent recruitment of src kinases in gpcr signaling;PID BioCarta;100230 |
Pathway | Insulin signaling pathway;KEGG PATHWAY;hsa04910 |
Pathway | VEGF signaling pathway;KEGG PATHWAY;hsa04370 |
Pathway | VEGF signaling pathway;PANTHER;P00056 |
Pathway | ErbB signaling pathway;KEGG PATHWAY;hsa04012 |
Pathway | p38 mapk signaling pathway;PID BioCarta;100085 |
Pathway | links between pyk2 and map kinases;PID BioCarta;100057 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | t cell receptor signaling pathway;PID BioCarta;100022 |
Pathway | il 2 signaling pathway;PID BioCarta;100130 |
Pathway | GnRH signaling pathway;KEGG PATHWAY;hsa04912 |
Pathway | fc epsilon receptor i signaling in mast cells;PID BioCarta;100165 |
Pathway | Gap junction;KEGG PATHWAY;hsa04540 |
Pathway | the igf-1 receptor and longevity;PID BioCarta;100115 |
Pathway | integrin signaling pathway;PID BioCarta;100123 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | Tight junction;KEGG PATHWAY;hsa04530 |
Pathway | cadmium induces dna synthesis and proliferation in macrophages;PID BioCarta;100209 |
Pathway | il 6 signaling pathway;PID BioCarta;100126 |
Pathway | Ras Pathway;PANTHER;P04393 |
Pathway | Acute myeloid leukemia;KEGG PATHWAY;hsa05221 |
Disease | Thyroid cancer;KEGG DISEASE;H00032 |
Disease | bladder cancer;GAD |
Disease | Cancer;FunDO |
Disease | anomalous connection of pancreatobiliary ducts;GAD |
Disease | Squamous cell carcinoma;KEGG DISEASE;H00040 |
Disease | H-ras allele loss;GAD |
Disease | Eating disorder;FunDO |
Disease | Skin cancers;KEGG DISEASE |
Disease | Bladder cancer;KEGG DISEASE;H00022 |
Disease | Actinic keratosis;FunDO |
Disease | Herpes;FunDO |
Disease | Thyroid carcinoma, follicular, somatic;OMIM |
Disease | lung cancer;GAD |
Disease | cervical cancer;GAD |
Disease | Systemic scleroderma;FunDO |
Disease | tumor progression of BCR/ABL negative chronic myeloproliferative disorders;GAD |
Disease | Cancers of endocrine organs;KEGG DISEASE |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | nodular type of malignant melanoma;GAD |
Disease | colorectal carcinomas;GAD |
Disease | Drug abuse;FunDO |
Disease | PSYCH;GAD |
Disease | Penile disease;FunDO |
Disease | schistosomiasis;GAD |
Disease | Hepatocellular carcinoma;KEGG DISEASE;H00048 |
Disease | Penile cancer;KEGG DISEASE;H00025 |
Disease | CANCER;GAD |
Disease | Pancreas disease;FunDO |
Disease | Cancers of the breast and female genital organs;KEGG DISEASE |
Disease | Costello syndrome;OMIM |
Disease | Cancers;KEGG DISEASE |
Disease | Bladder cancer, somatic;OMIM |
Disease | thyroid cancer;GAD |
Disease | Cervical cancer;KEGG DISEASE;H00030 |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | breast cancer;GAD |
Disease | Autism;GAD |
Disease | patient prognosis A retrospective study of 103 cases;GAD |
Disease | adenocarcinomas of the parotid gland;GAD |
Sequence Information | |
|---|---|
Nucleotide Sequence | >3265 : length: 1251 TGCCCTGCGCCCGCAACCCGAGCCGCACCCGCCGCGGACGGAGCCCATGCGCGGGGCGAACCGCGCGCCCCCGCCCCCGCCCCGCCCCGGCCTCGGCCCCGGCCCTGGCCCCGGGGGCAG TCGCGCCTGTGAACGGTGGGGCAGGAGACCCTGTAGGAGGACCCCGGGCCGCAGGCCCCTGAGGAGCGATGACGGAATATAAGCTGGTGGTGGTGGGCGCCGGCGGTGTGGGCAAGAGTG CGCTGACCATCCAGCTGATCCAGAACCATTTTGTGGACGAATACGACCCCACTATAGAGGATTCCTACCGGAAGCAGGTGGTCATTGATGGGGAGACGTGCCTGTTGGACATCCTGGATA CCGCCGGCCAGGAGGAGTACAGCGCCATGCGGGACCAGTACATGCGCACCGGGGAGGGCTTCCTGTGTGTGTTTGCCATCAACAACACCAAGTCTTTTGAGGACATCCACCAGTACAGGG AGCAGATCAAACGGGTGAAGGACTCGGATGACGTGCCCATGGTGCTGGTGGGGAACAAGTGTGACCTGGCTGCACGCACTGTGGAATCTCGGCAGGCTCAGGACCTCGCCCGAAGCTACG GCATCCCCTACATCGAGACCTCGGCCAAGACCCGGCAGGGCAGCCGCTCTGGCTCTAGCTCCAGCTCCGGGACCCTCTGGGACCCCCCGGGACCCATGTGACCCAGCGGCCCCTCGCGCT GGAGTGGAGGATGCCTTCTACACGTTGGTGCGTGAGATCCGGCAGCACAAGCTGCGGAAGCTGAACCCTCCTGATGAGAGTGGCCCCGGCTGCATGAGCTGCAAGTGTGTGCTCTCCTGA CGCAGGTGAGGGGGACTCCCAGGGCGGCCGCCACGCCCACCGGATGACCCCGGCTCCCCGCCCCTGCCGGTCTCCTGGCCTGCGGTCAGCAGCCTCCCTTGTGCCCCGCCCAGCACAAGC TCAGGACATGGAGGTGCCGGATGCAGGAAGGAGGTGCAGACGGAAGGAGGAGGAAGGAAGGACGGAAGCAAGGAAGGAAGGAAGGGCTGCTGGAGCCCAGTCACCCCGGGACCGTGGGCC GAGGTGACTGCAGACCCTCCCAGGGAGGCTGTGCACAGACTGTCTTGAACATCCCAAATGCCACCGGAACCCCAGCCCTTAGCTCCCCTCCCAGGCCTCTGTGGGCCCTTGTCGGGCACA GATGGGATCACAGTAAATTATTGGATGGTCTTGAAAAAAAAAAAAAAAAAA |
Protein Sequence | >3265 : length: 189 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS |